KEGG   Podospora anserina: PODANSg5649Help
Entry
PODANSg5649       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pan  Podospora anserina
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PODANSg5649
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    PODANSg5649
   00603 Glycosphingolipid biosynthesis - globo series
    PODANSg5649
   00604 Glycosphingolipid biosynthesis - ganglio series
    PODANSg5649
   00511 Other glycan degradation
    PODANSg5649
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PODANSg5649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 584 aa AA seqDB search
MFSRLPSLVTALCFLYPLFLNPVAAVWPAPQKFTKGDGVQFLNQNIEVTYNGAFIPYTYG
YTPSGFTSKEIVQAGVSRALTGIFNSKFVPWILHKPNTKYEPDLDKLEWLQTLEIIQTAS
DDRSAFKPLAGEVDESYNLTLSKSGHAKLTAVSSIGILRGLETFSQLFYQHSSGTFWYTP
YAPVSITDSPKFPHRGILLDTARHFFPVEDILRTIDAMAWSKLNRLHIHVTDSQSWPLVI
PSMPELSEKGAHHPSETYSPSDVESIQKYGAVRGVEVYFEIDMPGHIGSVSLSHPELIVA
YNEQPYHWWCAQPPCGAFKLNNTAVDEFLGRLFDDLLPRVERYAAYFHTGGDELNRNDSM
LDEGIRSNSSEVLQPLLQKFIDKQHERVREKGLTPVVWEEIPLEWNVTLGKGTVVQSWLG
AGAVKELVGMGHRVIDSNYNFWYLDCGRGQWITWENGLPFKTGYPFNDWCGPTKSWGLIY
SHDPTANLTEEEAKLVLGGEVAVWSETIDPMNLDGIVWPRASVAGEVLWSGRVDDNTGQN
RSQIEAFPRLTEFRERLVRRGVRASPISQEFCVQGEPWECEFAM
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcgtttgccgtcgctcgtgacggctctctgctttctataccccctcttcctc
aaccctgtagcagctgtatggcctgcccctcaaaaattcaccaaaggagatggcgtccag
tttctgaatcagaacattgaagtcacatacaacggtgcatttatcccctacacttacggc
tacacgccctccggcttcaccagcaaagaaatcgtccaagccggcgtctccagagccctc
accgggatattcaacagcaagtttgtcccctggatcctccacaagccaaacacgaagtac
gaacccgacctcgacaaattagaatggctccaaactctcgaaatcatccagacagcctcg
gacgaccgctccgccttcaagccactagcaggcgaagtcgacgagtcctacaacctgacc
ctaagcaaatccggccacgccaaactcacagccgtctcctcaatcggcatcctccgcggc
ctggaaaccttttcccagctcttctaccagcactcatcaggcacattctggtacaccccc
tacgcccccgtctcaataaccgactcccccaagttcccccaccggggcatcctcctcgac
acggcccgccattttttcccagtggaggacatcctcaggacaatcgacgccatggcctgg
agtaaactcaaccgcctccacatccacgtcacagactcccaatcctggcctcttgtcatc
ccatcaatgccagaactttccgagaaaggcgcacaccaccccagcgagacttactcccct
tccgacgtggaatcaatccagaaatacggcgccgtccgcggggtggaggtctatttcgag
attgacatgccggggcatattggttccgtctcgctgtcgcatccggaactgattgtcgcg
tataatgagcagccgtatcactggtggtgcgcccagccgccgtgcggggcgttcaagctc
aacaacacggctgttgacgagtttttggggaggttgtttgatgatcttttgcccagggtg
gagaggtacgcggcttattttcacacggggggggatgagttgaataggaatgattctatg
cttgatgaggggattaggtcgaatagttcggaggttttgcagccgttactgcaaaagttt
attgataagcagcatgagagggttagggaaaaggggctgacgccggtggtgtgggaggag
attcctttggagtggaatgttacacttggaaaagggacggtggtgcagagctggcttggg
gcgggggcggtgaaggagttggttgggatggggcatagggttattgatagtaattataat
ttttggtatctcgactgtggaagggggcagtggatcacctgggagaatgggctgcctttc
aagacggggtatccgtttaatgactggtgcggaccgacaaagtcttgggggctgatttac
tctcatgatcctactgccaaccttactgaggaggaggcgaagcttgtgcttgggggggag
gtggcggtttggagtgagacgattgatccgatgaatctggatggtattgtctggcctagg
gcgagcgtggcgggggaggtgctttggtccgggagggttgatgataataccgggcagaac
aggagccagattgaggcttttcctagacttactgagtttagggagagattggtcaggagg
ggggtgagggcgagcccgatttcgcaggagttttgcgtgcagggtgagccgtgggagtgt
gagtttgctatgtga

DBGET integrated database retrieval system