KEGG   Podospora anserina: PODANSg5651Help
Entry
PODANSg5651       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pan  Podospora anserina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PODANSg5651
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PODANSg5651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 575 aa AA seqDB search
MKITIYEASNRLGGWIDSEEVKVKGLTGEKGSVWFQRGARMVNPQHSKGPLYRYDDLAFY
LLVTQLGLSEQLQNAPETEVMGKYIYYPDHLVQLPDKSMTLLEVWQTLRKEPLFEGLFPS
LWSFGKTRLRQLFTSTLKPPTQDAHSKNELSVGEHFTKMFGRPDLVENVLSAVMHGIYGG
DVWKLSVQRTPFWDVLKDGRYPRLPPAYTWLDTPDAELLNWVRRDACRELAEDHLTTSAH
WFPSGLNELTDALVEFLKKRGNVTIRLGHRVTSMTYAAKADRVAIRTSKQPTPITYEKVI
STLYAKTLADICSPGTLPSLEKSTATTIRVVNLWYPEPGLNHPHKGFGYLIPQSVPFEEN
RHFILGVMFDSDREWVPNPHRPGQYINRGKDTIRGTKLTVMMGGHYWDHLPPHEIPDEQT
AIRYAKKAVARHLGFSRATNDTAVVSTKLCKDCIPQQLVGHRERMKAAHEELLAAFRGRV
AVAGGSYQVPGVLPSIRAALDIARQIRGSFHWQDATRAVETKSITVGDTGLWRFAAPVRS
MVRVDKSGFTALRGHDRRLAIIRRKRAESEREREE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcacgatatacgaggcgagcaaccggcttggtgggtggatcgattcggaggag
gtcaaggtgaaggggctgactggggagaaggggagtgtgtggtttcagaggggggcgagg
atggtcaacccgcagcattcgaaggggccgttgtatcggtacgatgatttggcgttttat
ctcctggttacccaactggggttatctgagcagctccagaacgcgcctgagacggaggtt
atgggaaagtatatttactaccctgaccatttggttcagctcccggacaagtccatgacc
ctgctggaagtatggcagactttgagaaaggaaccgcttttcgaggggttgtttccgtcg
ctctggagctttgggaagacgaggttacggcaactttttaccagcactctcaagcctcct
acacaggatgctcactcgaagaacgaactctcggtgggggaacactttacgaaaatgttt
ggacgccccgacttggtcgagaatgtcctttcggcggtcatgcacggcatctatggtggt
gacgtctggaagctgagcgtgcagaggacgccgttttgggatgtcctcaaggacgggaga
tacccccggttacctccagcgtacacctggctcgataccccagatgccgagctgctgaac
tgggtacggagagatgcatgcagggaactggccgaggaccatctcaccacttcggcgcat
tggttcccttctggcctcaacgagctgacggacgcgctggtggagtttttgaagaagcgg
ggaaatgtcacgattaggttgggccatcgggttacgtccatgacatatgccgccaaggcg
gatcgtgtcgctatcaggacgtccaaacagccgaccccgatcacgtacgaaaaggtcatc
tcgacgctctacgccaaaacactcgcggatatctgctcccctggcaccctcccctcgttg
gagaaatcaaccgcgacgaccatccgggtggtgaacctgtggtatccagaaccaggcctc
aaccacccacacaagggctttggatatctcatcccacaatctgtcccgtttgaagaaaac
agacatttcatcctgggggtgatgttcgactcggacagggaatgggttccgaacccccac
cggccggggcagtacatcaaccgaggcaaggacacgatcaggggaacgaaacttaccgtc
atgatggggggccactactgggaccacctccccccgcatgaaatccccgacgagcaaact
gccattagatacgcgaagaaagctgtggcgagacacctcggcttttcgagagcgacgaat
gacactgctgttgtcagcacgaagctctgtaaggattgcatccctcagcagcttgtcggt
caccgggagcggatgaaggctgcgcatgaggagttgctggcggcgtttaggggacgggtt
gctgtcgcgggggggtcatatcaggtgccgggggtgctgccgtctattagggcggcgctg
gatattgctaggcagattagggggagttttcactggcaggatgcgactagggcggtggag
acaaagtcgattacggtgggggatacggggttgtggaggtttgcggcgccagtgaggtcg
atggttagggttgataaatcggggtttacggcgttgagggggcatgataggaggctggcg
attataaggaggaagcgtgcggagtctgagagggagagggaggagtga

DBGET integrated database retrieval system