KEGG   Podospora anserina: PODANSg5718Help
Entry
PODANSg5718       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pan  Podospora anserina
Pathway
pan04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PODANSg5718
Enzymes [BR:pan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PODANSg5718
Chaperones and folding catalysts [BR:pan03110]
 Protein folding catalysts
  Protein disulfide isomerase
   PODANSg5718
Membrane trafficking [BR:pan04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    PODANSg5718
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PODANSg5718
  Exosomal proteins of colorectal cancer cells
   PODANSg5718
  Exosomal proteins of bladder cancer cells
   PODANSg5718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_8 Thioredoxin_7 OST3_OST6 Thioredoxin_2 AhpC-TSA Redoxin Calsequestrin Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 6193082
NCBI-ProteinID: XP_001908683
UniProt: B2AY82
Position
1
AA seq 508 aa AA seqDB search
MQKVHRIALGLLAAAAIATASDVVQLKKDTFDDFVKANDLVLAEFFAPWCGHCKALAPEY
EEAATTLKEKNIKLAKIDCTEETELCQQHGVEGYPTLKVFRGLDNVGPYKGQRKAGAITS
YMIKQSLPAVSDVTKDTLEEFKKADKVVIVAYVDAADKASSEAFSAVAEKLRDDYPFGVS
TDAALAEAEGVKAPAVVVYKDFDEGKSVFTERFEAEAIQKFAKTAATPLIGEIGPETYSD
YMSAGLPLAYIFAETAEERKEISEKLKPIAEAQRGVVNFGTIDAKAYGAHAGNLNLKTDK
FPAFAIQETAKNQKFPFDQEKEITLEAIKTFVDDFVAGKVEPSIKSEPIPEKQEGPVTVV
VAKSYNDIVLDDTKDVLIEFYAPWCGHCKSLAPKYDELASLYAKSEFKDKVVIAKVDATA
NDVPDEIQGFPTIKLYPAGAKNEPVTYSGSRTVDDLIKFVAENGKYKASVSEEAEEPSAA
PAASEEASSAEPAAETKEAAKEADHDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggttcacagaatcgccctcggcctcctcgccgccgcggccatcgccactgct
tccgacgttgtccagctcaagaaggacaccttcgacgactttgtcaaggccaacgacctc
gtccttgctgagttcttcgccccgtggtgcggccactgcaaggccctcgccccagagtac
gaggaggctgccacgacgctgaaggagaagaacatcaagctcgccaagatcgactgcaca
gaagagacggagctctgccaacaacacggcgttgagggttaccccaccctcaaggtcttc
cgcggcctcgacaatgtcggcccctacaagggtcagcgcaaggctggtgccatcacctcc
tacatgatcaagcagtccctccccgctgtgtccgacgtcaccaaggacactctggaggag
ttcaagaaggccgacaaggtcgtcatcgtcgcctacgtcgacgccgccgacaaggcctcc
agcgaggctttctctgccgtcgctgagaagctccgcgacgactaccccttcggtgtcagc
accgatgccgctctcgccgaggctgagggcgtcaaggcccccgccgtcgttgtctacaag
gactttgacgagggcaagtccgtcttcaccgagaggttcgaggctgaggccatccagaag
ttcgccaagacggccgccactcccctcatcggcgagatcggccccgagacctactccgac
tacatgtcggccggccttccccttgcctacatcttcgccgagacggccgaggagcgcaag
gagatcagcgagaagctcaagcccatcgccgaggcccagcgtggtgttgtcaactttggc
accatcgacgccaaggcctatggtgcccacgctggcaacctcaacctcaagaccgacaag
ttccccgccttcgccatccaggagacggccaagaaccagaagttccccttcgaccaggag
aaggagatcaccctcgaggccatcaagactttcgtcgacgactttgtcgccggcaaggtc
gagcctagcatcaagtctgagcccatccccgagaagcaggagggccccgtcacggttgtt
gttgccaagagctacaacgacattgtccttgacgacaccaaggatgtcctgatcgagttc
tacgccccgtggtgcggtcactgcaagtcccttgctcccaagtacgacgagctcgccagc
ctctacgccaagagcgagttcaaggacaaggttgtcattgccaaggttgatgccactgcc
aacgacgttcccgatgagattcagggcttccccaccatcaagctctaccccgccggcgcc
aagaacgagcccgtcacctactctggctcccgcaccgttgatgaccttatcaagttcgtt
gccgagaacggcaagtacaaggcttccgtctctgaggaggctgaggagccatcagctgcg
cccgccgcttctgaggaggccagctctgccgagcccgcggccgagaccaaggaggctgcc
aaggaggccgaccacgacgagctctag

DBGET integrated database retrieval system