KEGG   Podospora anserina: PODANSg5718Help
Entry
PODANSg5718       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pan  Podospora anserina
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:pan04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 508 aa AA seqDB search
MQKVHRIALGLLAAAAIATASDVVQLKKDTFDDFVKANDLVLAEFFAPWCGHCKALAPEY
EEAATTLKEKNIKLAKIDCTEETELCQQHGVEGYPTLKVFRGLDNVGPYKGQRKAGAITS
YMIKQSLPAVSDVTKDTLEEFKKADKVVIVAYVDAADKASSEAFSAVAEKLRDDYPFGVS
TDAALAEAEGVKAPAVVVYKDFDEGKSVFTERFEAEAIQKFAKTAATPLIGEIGPETYSD
YMSAGLPLAYIFAETAEERKEISEKLKPIAEAQRGVVNFGTIDAKAYGAHAGNLNLKTDK
FPAFAIQETAKNQKFPFDQEKEITLEAIKTFVDDFVAGKVEPSIKSEPIPEKQEGPVTVV
VAKSYNDIVLDDTKDVLIEFYAPWCGHCKSLAPKYDELASLYAKSEFKDKVVIAKVDATA
NDVPDEIQGFPTIKLYPAGAKNEPVTYSGSRTVDDLIKFVAENGKYKASVSEEAEEPSAA
PAASEEASSAEPAAETKEAAKEADHDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggttcacagaatcgccctcggcctcctcgccgccgcggccatcgccactgct
tccgacgttgtccagctcaagaaggacaccttcgacgactttgtcaaggccaacgacctc
gtccttgctgagttcttcgccccgtggtgcggccactgcaaggccctcgccccagagtac
gaggaggctgccacgacgctgaaggagaagaacatcaagctcgccaagatcgactgcaca
gaagagacggagctctgccaacaacacggcgttgagggttaccccaccctcaaggtcttc
cgcggcctcgacaatgtcggcccctacaagggtcagcgcaaggctggtgccatcacctcc
tacatgatcaagcagtccctccccgctgtgtccgacgtcaccaaggacactctggaggag
ttcaagaaggccgacaaggtcgtcatcgtcgcctacgtcgacgccgccgacaaggcctcc
agcgaggctttctctgccgtcgctgagaagctccgcgacgactaccccttcggtgtcagc
accgatgccgctctcgccgaggctgagggcgtcaaggcccccgccgtcgttgtctacaag
gactttgacgagggcaagtccgtcttcaccgagaggttcgaggctgaggccatccagaag
ttcgccaagacggccgccactcccctcatcggcgagatcggccccgagacctactccgac
tacatgtcggccggccttccccttgcctacatcttcgccgagacggccgaggagcgcaag
gagatcagcgagaagctcaagcccatcgccgaggcccagcgtggtgttgtcaactttggc
accatcgacgccaaggcctatggtgcccacgctggcaacctcaacctcaagaccgacaag
ttccccgccttcgccatccaggagacggccaagaaccagaagttccccttcgaccaggag
aaggagatcaccctcgaggccatcaagactttcgtcgacgactttgtcgccggcaaggtc
gagcctagcatcaagtctgagcccatccccgagaagcaggagggccccgtcacggttgtt
gttgccaagagctacaacgacattgtccttgacgacaccaaggatgtcctgatcgagttc
tacgccccgtggtgcggtcactgcaagtcccttgctcccaagtacgacgagctcgccagc
ctctacgccaagagcgagttcaaggacaaggttgtcattgccaaggttgatgccactgcc
aacgacgttcccgatgagattcagggcttccccaccatcaagctctaccccgccggcgcc
aagaacgagcccgtcacctactctggctcccgcaccgttgatgaccttatcaagttcgtt
gccgagaacggcaagtacaaggcttccgtctctgaggaggctgaggagccatcagctgcg
cccgccgcttctgaggaggccagctctgccgagcccgcggccgagaccaaggaggctgcc
aaggaggccgaccacgacgagctctag

DBGET integrated database retrieval system