KEGG   Podospora anserina: PODANSg5718Help
Entry
PODANSg5718       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pan  Podospora anserina
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PODANSg5718
Enzymes [BR:pan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PODANSg5718
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PODANSg5718
  Exosomal proteins of colorectal cancer cells
   PODANSg5718
  Exosomal proteins of bladder cancer cells
   PODANSg5718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 508 aa AA seqDB search
MQKVHRIALGLLAAAAIATASDVVQLKKDTFDDFVKANDLVLAEFFAPWCGHCKALAPEY
EEAATTLKEKNIKLAKIDCTEETELCQQHGVEGYPTLKVFRGLDNVGPYKGQRKAGAITS
YMIKQSLPAVSDVTKDTLEEFKKADKVVIVAYVDAADKASSEAFSAVAEKLRDDYPFGVS
TDAALAEAEGVKAPAVVVYKDFDEGKSVFTERFEAEAIQKFAKTAATPLIGEIGPETYSD
YMSAGLPLAYIFAETAEERKEISEKLKPIAEAQRGVVNFGTIDAKAYGAHAGNLNLKTDK
FPAFAIQETAKNQKFPFDQEKEITLEAIKTFVDDFVAGKVEPSIKSEPIPEKQEGPVTVV
VAKSYNDIVLDDTKDVLIEFYAPWCGHCKSLAPKYDELASLYAKSEFKDKVVIAKVDATA
NDVPDEIQGFPTIKLYPAGAKNEPVTYSGSRTVDDLIKFVAENGKYKASVSEEAEEPSAA
PAASEEASSAEPAAETKEAAKEADHDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggttcacagaatcgccctcggcctcctcgccgccgcggccatcgccactgct
tccgacgttgtccagctcaagaaggacaccttcgacgactttgtcaaggccaacgacctc
gtccttgctgagttcttcgccccgtggtgcggccactgcaaggccctcgccccagagtac
gaggaggctgccacgacgctgaaggagaagaacatcaagctcgccaagatcgactgcaca
gaagagacggagctctgccaacaacacggcgttgagggttaccccaccctcaaggtcttc
cgcggcctcgacaatgtcggcccctacaagggtcagcgcaaggctggtgccatcacctcc
tacatgatcaagcagtccctccccgctgtgtccgacgtcaccaaggacactctggaggag
ttcaagaaggccgacaaggtcgtcatcgtcgcctacgtcgacgccgccgacaaggcctcc
agcgaggctttctctgccgtcgctgagaagctccgcgacgactaccccttcggtgtcagc
accgatgccgctctcgccgaggctgagggcgtcaaggcccccgccgtcgttgtctacaag
gactttgacgagggcaagtccgtcttcaccgagaggttcgaggctgaggccatccagaag
ttcgccaagacggccgccactcccctcatcggcgagatcggccccgagacctactccgac
tacatgtcggccggccttccccttgcctacatcttcgccgagacggccgaggagcgcaag
gagatcagcgagaagctcaagcccatcgccgaggcccagcgtggtgttgtcaactttggc
accatcgacgccaaggcctatggtgcccacgctggcaacctcaacctcaagaccgacaag
ttccccgccttcgccatccaggagacggccaagaaccagaagttccccttcgaccaggag
aaggagatcaccctcgaggccatcaagactttcgtcgacgactttgtcgccggcaaggtc
gagcctagcatcaagtctgagcccatccccgagaagcaggagggccccgtcacggttgtt
gttgccaagagctacaacgacattgtccttgacgacaccaaggatgtcctgatcgagttc
tacgccccgtggtgcggtcactgcaagtcccttgctcccaagtacgacgagctcgccagc
ctctacgccaagagcgagttcaaggacaaggttgtcattgccaaggttgatgccactgcc
aacgacgttcccgatgagattcagggcttccccaccatcaagctctaccccgccggcgcc
aagaacgagcccgtcacctactctggctcccgcaccgttgatgaccttatcaagttcgtt
gccgagaacggcaagtacaaggcttccgtctctgaggaggctgaggagccatcagctgcg
cccgccgcttctgaggaggccagctctgccgagcccgcggccgagaccaaggaggctgcc
aaggaggccgaccacgacgagctctag

DBGET integrated database retrieval system