KEGG   Podospora anserina: PODANSg5780Help
Entry
PODANSg5780       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pan  Podospora anserina
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    PODANSg5780
  Amino acid metabolism
   00380 Tryptophan metabolism
    PODANSg5780
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PODANSg5780
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     PODANSg5780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1126 aa AA seqDB search
MSCPFHVEGAAKPPGSSHSARSESTPKPATPALEEIGEGEPIPQPPERWLTGNLGEINPE
FSMGSLWRLADVYGPIFTLNLVKRKIVVLSSHALINEVCDEKRFEKKVAGAQEAIRVFVK
NGLFTSYNEEEEWGIAHRTLLPAFGPLHVRTMFPKMTDILSQMILRWDRFGPDYRISTHD
DFTRLAFDVIGLCAFNYRFNAFYSEELIPFAKQLGDVLIETGKRTSRPEIQNTLAFLSKR
QMMENIHSMWKVCDDIVAERKANPRPDIDDTLNVMLNAKDPVTGKGFTDENIRYQMATFL
VAGHDTSAGTMMFLFYNLLKHPEALQKCYAEVDAVLGDRELQLEDIPKLKYIDAAMKEAL
RFCGPIPAFMRQAKETTIIGGKYKITPNESLVFNLKGLHNDPAVWGSDAAEFRPERFLNG
GWERLPPNSWKPFGTGVRSCIGRYLAEQEVLITMAMVLQRFVIEMADPDYELKIKSTLTI
KPDEFYIKARRRPGKDHLFNFSAGAAPAPAPSSKTANGASANSNLKPFSVFYGGNSGTCK
SFAEDLETNAANHGLSVPAKVQSLDDAVENLPKDHPLVIVTSSYEGLPPDNARNFVAWLE
TRAKDPSNSELLKGVSYAVFGAGNKDWASTYHRIPKLVDELLEKLGAARLVATGFVDVSQ
DIVGPLEEWKLTLFPALREAVGVTAAVKTEELRVEITQPTAPSKLAGEQLSQGLVLVNKV
LAKKGLGPEKRQIDILLPPGVQYRSGDYLAIQPFNPRDSIRRVLSRFGLHPDDLITVSGT
TKEHLKSESGGPISVFELIGTRVELANPASQRQVAHLASLSSGLEADKLRVLASDEEYPT
SVLAKRFSVLDLLEDFPSCKLSFASYLDMLSPLSPRQYSISSSPLAQKPLPDQGSGWSSE
EGVDLEKASLTATLTYDVYNSPLMSHPETKSFNGVSSSYLASLQPGSRLRCFVRKTNAPF
RLPSDPATPVVMVAAGTGVAPMRAFLQERAAVAGARGGYHKSGLGPAMLYYGCRDFEEDY
LYKEELGQWEKEGVVRVRAAFSRRAGEGGRTGHVDELIWEDREELKGLIKQGAKILVCGS
AGRLGRSTAEVCLRIYEDEFPDRGREGAEEWLGKMKEERYVSDVFG
NT seq 3381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtcccttccacgttgaaggggctgccaagccaccgggttcatcacattcagca
cgttcagagtcaacacccaagccagcaacacctgcgctggaagagatcggagaaggagag
ccaatccctcaaccacccgagagatggcttaccggcaacctgggagagatcaaccccgag
ttctctatgggatccctatggagacttgctgatgtctacggtcccatcttcacactcaac
ctcgtcaagagaaagattgtcgtcctgtccagccatgctctgataaacgaggtgtgcgac
gagaagcgattcgagaagaaagttgccggtgcccaggaggccatcagggtgtttgtcaaa
aacggtctattcacatcatacaacgaggaagaagaatggggaatcgcccacagaactctt
ctaccggcctttggcccgctacatgtccgcaccatgttccccaagatgacggatatcctc
tctcagatgatcctccgctgggatcgcttcggcccagactaccgcatctcaacccatgac
gatttcactcgtctggcctttgacgttatcggtctctgtgccttcaactaccgcttcaat
gccttctactccgaggagctaatcccgttcgccaagcagctgggtgatgttctcatcgag
actggcaagcggaccagtcgtcccgagatccagaacactctggccttcctcagcaagagg
cagatgatggagaatattcattccatgtggaaggtctgcgacgatattgtcgcagagcgc
aaggccaatccccgccccgatatcgacgacactctcaatgtcatgctcaacgccaaagac
cctgtcactggaaaggggttcaccgatgagaatatccgataccagatggctaccttcctg
gtagcaggacacgacacttcggctggtaccatgatgtttttgttctacaaccttctcaag
catcccgaggccctgcagaagtgctatgccgaggtcgatgctgtgctcggagacagggag
ctgcagttggaggacattcccaaactcaagtacattgatgctgccatgaaggaggctctt
cgtttctgtggtcctattccggctttcatgagacaggcgaaggagaccaccatcattggc
ggcaagtacaagatcactcccaacgagagtctggtgttcaatctcaagggtcttcacaac
gaccctgctgtttggggctctgacgctgccgagttcaggccagaaaggttcctcaatggt
ggttgggaaaggctgccacccaactcttggaagcctttcgggactggtgttcgctcgtgt
attggtcggtatttggctgagcaggaggttcttatcaccatggctatggtgttgcagcgg
ttcgtgattgagatggctgatcctgattatgagctcaagatcaagtctacacttaccatc
aagcctgatgagttctacatcaaggctcgcagacgccctggaaaggaccacctcttcaac
ttcagcgctggtgccgctcctgccccagcaccttctagcaagacagccaacggagcttct
gccaactccaacttgaagccgttttccgtcttttatggtggcaactcgggaacttgcaag
tcttttgccgaggatctcgagaccaacgcggcgaaccacggtctgtccgttccagctaag
gttcagagcctggatgatgccgtggaaaacctgccaaaggatcaccccctcgtcatcgtc
acctcctcttacgaaggcctcccccccgacaacgcccgcaactttgtcgcctggctcgag
acccgtgccaaggaccccagcaacagcgagcttctcaagggcgtctcgtacgccgtcttt
ggcgctggcaataaagactgggcctcgacctaccaccgcatccccaagttggttgatgag
ctcctcgagaaactcggcgccgcacgtctcgtcgctaccggttttgtcgacgtcagccag
gatattgtcggtccccttgaagagtggaaactgaccctcttccccgccctccgcgaagca
gtcggtgtgacggcagccgtcaagacggaggagctccgagtggaaatcacccaaccgacc
gcgccgtccaagctagcaggcgagcagttatctcaaggtctcgtcttggtcaacaaagtc
ctcgccaagaaaggcctcggtccggaaaaacgccaaatcgacattctgctccctcctggt
gtgcaataccgcagcggggattacttggccatccaaccctttaacccccgggactcgatc
cgccgcgtgctcagccgcttcggcctccaccccgacgatctcatcaccgtctcggggacc
accaaagaacacctcaagtctgagtctggggggccaatttcggtgtttgaactcatcggc
acaagagtcgaactcgccaaccctgcttcccagcgccaggtggctcacttggcttctctc
tcgtccggtctggaggcagataaacttcgtgttttggcctcggatgaggagtaccctacc
tctgtcctggcaaagaggttttctgtcttggacctgctggaggattttccctcttgcaag
ctgagctttgcttcgtatcttgacatgctgagtccgctgtctcctaggcagtatagcatt
tccagttccccgctcgcgcagaaaccgctgcctgatcaggggtctgggtggtcgagcgag
gagggggttgatctggagaaggcgagcttgacggctacgttgacgtatgatgtgtacaac
tcccctttgatgtcgcatcctgagacgaagtccttcaacggcgtcagttcttcctacctc
gcctcgttacagcccggctcgagactgcggtgttttgtgagaaagacgaatgcgccgttt
cggctgccgagtgacccggctacgccggtggtgatggttgctgctgggacgggggttgcg
ccgatgagggcttttctgcaggaacgggctgctgttgcgggtgctaggggggggtatcac
aagtcaggtcttggtcctgctatgctgtactatgggtgtagggattttgaggaggattac
ctatacaaagaggagttgggtcaatgggagaaggagggggttgttagagtacgggcggcc
ttttcgaggagggcgggcgagggagggaggacggggcatgtggatgagctgatttgggag
gatagggaggagttgaaggggttgattaagcagggggccaagatacttgtgtgtgggagc
gcggggaggttggggaggagcacggcggaggtttgtttgaggatttatgaggatgagttt
cctgatagggggagggagggggcggaggagtggcttgggaagatgaaggaggagaggtat
gttagtgatgtttttggttga

DBGET integrated database retrieval system