KEGG   Podospora anserina: PODANSg5783Help
Entry
PODANSg5783       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PODANSg5783
Peptidases [BR:pan01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PODANSg5783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 253 aa AA seqDB search
MATEKKYFTMLENHPEVFTTLAHTLGLPPSITFHDIYSFSPPALAHIPRPCLALIAIIPL
TPSWALDRQSEDARLGDPKTYYHGNSNPSSSAPIIWFQQTIGDACGSYALLHCSINGPAA
SLIHPGSTLDQIRKDAAPLPREERAELLYDNKAFEEAHQSVAAMGDTAEPRDRSVGLGQH
FVGYVKANGRLWELEGSREGPLDRGELGDDEDVLSPKALELGLGRIIKLEHESGGQDLRF
SCIAMALKDEQSE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgagaagaaatacttcaccatgctcgaaaaccaccccgaagtcttcaccacc
ctcgctcacaccctcggcctccccccttccatcaccttccacgacatctactccttctcc
cccccagccctcgcccacatcccccgcccctgcctcgccctcatagccatcattcccctc
accccctcctgggccctcgaccgccaatccgaagacgcccgtctcggcgaccccaaaacc
tactaccacggcaacagcaacccctcctcctcagcccccataatatggttccaacaaacc
atcggcgacgcctgcggctcctacgccctcctccactgctctatcaacggccccgccgcc
tccctcatccatcccggcagcaccctcgatcaaattcgcaaggacgcagccccgttgcca
agagaagaacgtgcagaattattgtacgacaacaaggcatttgaagaggcccaccaatcc
gtagcggcaatgggcgataccgccgagccaagagacaggtccgtagggctaggccaacat
ttcgtcggttacgtcaaagcaaacggacggctctgggagttggaagggagcagagagggt
ccgttggacaggggtgagctaggggatgacgaagacgtcctaagccccaaggcgttggag
ttaggtctgggtaggataatcaagttggaacacgagtctggtgggcaagacttgaggttt
agttgtattgccatggcactgaaagatgagcaatccgagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system