KEGG   Podospora anserina: PODANSg5850Help
Entry
PODANSg5850       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
pan  Podospora anserina
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PODANSg5850
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PODANSg5850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 653 aa AA seqDB search
MHILDYSTTLAALLLTTSNLASAEPIPVPAVQLSQPNHDLILSPRARPNAPSGGYAPQEV
NCPRNKPTVRLADGISKQEEDWLGKRRKETVKPMIDFLKRANLEGFDAEAYINRVAPDVK
DLPNVGIAVSGGGYRALMNGAGFVAAADSRTTGATGEGQIGGLLQSSTYLAGLSGGGWLV
SSIYTNNFSTVETLRNGREGSSIWKFDRSIFIGPNLPGIFDTTRYWSRVARQVAAKADAG
WGRALGYQLIDAEDGGPAYTFSSIALDDEFSAARTPFPILVANGRYPGERIISLNATVYE
FNPYEMGSYDPTTYGFVPMEYLGSNFSQGVIPSSGKCVKGFDSVSYIYGTSSSLFNAFML
QNISSVEGVPTFLLNAANATLNILDSNENDIAQYEPNPFLGWNNATNPSAQKIELDLVDG
GLDLQNIPLHPPHPTLPPRRCHFCGRQLGRHDAQLAEWHRPPRQFGTAPKAPSPTARWFP
PVPDQNTFINLGLNNRPTFFGCDVKNFTLEAGQKVPPLLVYIPNAPYSANSNVSTFTSSY
PESQRNEIITNGYNAATQGNGTLDGEWNKCVACAVLSRSLARTGTGVPGECGRCFERYCW
DGRLDTKAVEGEYEPGFRVGDASTKDSAAGRAVVMGTGMGLVVGLLGVVVMIL
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcatattctagattactctaccaccctcgctgctctcctcctcaccacctccaacctt
gcctccgccgaacccatcccagtcccagctgtccagctctcccaacccaaccatgattta
atcctcagccctcgcgcgcgtcccaacgcgcccagcggcggctatgcgccccaggaagtc
aactgtcccagaaacaaacccactgtccgtcttgccgatggcatctccaagcaggaggag
gactggctcgggaagcgaaggaaggagacggtgaagcccatgattgacttcttgaagagg
gccaatctggaagggttcgatgccgaggcttacatcaaccgtgtggctccggatgtgaag
gatcttcccaatgttgggattgccgtttcggggggtggttacagggcgttgatgaatggg
gccgggttcgtcgctgctgccgacagcagaaccacgggtgcgactggggagggacagatt
ggggggttgctgcagagcagtacttatttggctggtttgtctggtggtggttggttggtg
tcaagcatttacaccaacaactttagcacggttgagacgttgaggaacgggagggagggg
agcagtatttggaagtttgataggagtatctttattgggccgaacttgcctgggattttt
gatactaccaggtactggtctagggtggctaggcaggttgctgcgaaggcggatgctggc
tggggccgtgccctgggttatcaactcatcgacgccgaagacggcgggccggcctacacc
ttctcctccatcgccctagacgatgagttctccgccgcccgcacccccttccccatcctc
gtagccaacggccgctacccgggggagaggatcatctccctcaacgccacggtctacgag
ttcaacccttacgaaatgggctcctacgatcccaccacgtacggttttgttcccatggag
tacctcggctccaacttctcccagggcgtcatcccctccagcggaaagtgcgtcaagggg
tttgattccgtgtcctatatctacggcacctcctccagcctcttcaacgccttcatgctc
caaaacatttcctcggtcgaaggcgtccctaccttcctcctcaacgcggcaaacgcaacc
ctcaacatcctagacagcaacgaaaacgacattgcgcagtacgaacccaacccattcctg
ggctggaacaacgccaccaacccgagcgcgcaaaaaatcgagcttgatctcgtcgatgga
gggttagacctccaaaacatccccctccacccccctcatccaacccttccgccacgtcga
tgtcatttttgcggtagacagctcggcagacacgacgcacaactggccgaatggcaccgc
cctccgcgccagtttgggaccgctcccaaggcgccatcgccaacggcacgctggttccct
cccgtccccgaccaaaacacgtttattaacctcgggcttaacaaccggcccacgtttttc
gggtgtgacgtcaagaatttcactttggaggccgggcaaaaggtgcccccgttgctggtt
tacatccctaatgctccttatagcgccaattcgaacgtctcgacttttacgagtagttac
cccgagagtcagaggaatgagatcatcactaatgggtataatgctgccacgcaggggaac
gggacgctggatggggagtggaacaagtgtgtggcgtgcgcggtgttgagtaggagtttg
gcgaggacggggacgggggtgccgggggagtgtgggaggtgttttgagaggtattgctgg
gatgggaggttggataccaaggctgtggagggggagtatgagccgggttttagggttggg
gatgcttctaccaaggatagtgctgctgggagggcggtggtaatggggactgggatgggg
ctggtggttgggttgttgggggtggtggtgatgattctttag

DBGET integrated database retrieval system