KEGG   Podospora anserina: PODANSg5851Help
Entry
PODANSg5851       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
pan  Podospora anserina
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PODANSg5851
  Amino acid metabolism
   00340 Histidine metabolism
    PODANSg5851
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PODANSg5851
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     PODANSg5851
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     PODANSg5851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 866 aa AA seqDB search
MESTLPLPFLISVNVPPGLGGEREGLNREEVSCLGTVFFTVKPQTYEKIFRFLGRHNTEF
QPFFDVTQLESRDDVVSLIDAGARKVFVRPEQLPDFAEFGSRVAPVVSGANPAQLASATE
HGLLVSDFDITAAETARFVEEAKAKKIASFFVKPIAGVDLEKFIGVAAQVGAIPILPSTD
VTSKEQAGKLAVPKILAASWKSDRADGLIPTVVVDEHDTALGLVYSSEESVGEALRTQTG
VYQSRKRGLWYKGASSGDTQELVRISLDCDNDALKFVVRQKGRFCHLEQSGCFGDLKGIK
KLEQTLVSRKRSAPQGSYTARLFSDEKLLRAKIMEEAEELCDAKTAEEVAFEAADLIYFA
MARVVAAGVSLADVEKSLDAKSFKVKRRQGDAKGRWAEKEGIKTETNGAAPPAPAPVKEE
PKKDERILMKVLDAGEVTTQELDAALKRPSQKSADAIMKIIVPIIDDVRKNGDKALLSYT
HKFERATSLTSPVLKAPFPESMMQLPAETIRAIDVSFENIKKFHAAQKDEKPLQVETMPG
VVCSRFSRPIEAVGLYVPGGTAVLPSTALMLGVPAMVAGCQKIVIASPPRSDGSITPEIV
YVAHKVGAESIVLAGGAQAVAAMAYGTESVTKVDKILGPGNQFVTAAKMYVSNDTNAGVG
IDMPAGPSEVLVVADKDANPAFVASDLLSQAEHGVDSQVILIAIDLTDAQLAAIEDEVHN
QAMALPRVDIVRGSIAHSLTVKVKTVEEAMEISNRYAPEHLILQIKDAEKAVEKVMNAGS
VFIGEWTPESVGDYSAGVNHSLPTYGFAKQYSGVNLASFVKHITSSNLTAEGLRNVGGAV
MQLAKVEELEAHRRAVEIRLEHMNKA
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgacgcttcctctgccgttcctcatcagcgtcaatgtcccgccggggctcgga
ggagagagggaggggctcaaccgcgaggaagtctcatgtctgggaactgtcttctttacc
gtgaagccgcagacatatgagaagattttccgtttcctcggccgccacaacaccgaattc
cagccctttttcgacgtgacacagctcgagtcccgcgatgatgtcgtttctcttatcgac
gctggcgctcgcaaggtgtttgtccgccctgaacagcttcccgatttcgccgagtttggc
tcccgagtagcccctgttgtgtctggcgccaacccggcgcaattggcttctgccactgag
cacggccttctcgtttccgactttgatatcaccgctgccgagactgcgcggtttgtcgag
gaggctaaggcgaagaaaatcgcttctttctttgtcaagcctatcgctggtgttgacctc
gaaaagttcattggtgttgcggcacaggttggcgctattcctattcttccctcgactgat
gtaaccagcaaggagcaggccggaaagcttgctgttcctaagattcttgctgcttcgtgg
aagtcagaccgtgccgatggcttgattcctaccgtggtggttgatgagcatgacactgct
cttggcttggtgtacagcagcgaggagagtgttggtgaggctctcaggacacagactggt
gtttaccagagccggaagcgtgggttgtggtacaagggtgcttcttctggggacactcag
gagcttgtgcggatatctctggattgcgacaatgatgcgctcaagtttgtggtgcggcaa
aaggggcggttctgtcacttggagcagtctggctgctttggcgatctgaagggtatcaag
aagctggagcagactcttgtctcaaggaagcggtctgcgccacaaggctcatacactgct
cgtctcttctctgatgagaagctgttgagggcgaagatcatggaggaggctgaggagctt
tgcgatgccaaaaccgccgaggaggttgctttcgaggccgcggatctcatctactttgcc
atggcgagagttgttgccgctggtgtgtctcttgctgacgttgaaaagagcctcgatgcc
aagagcttcaaggtcaagaggagacagggcgatgccaagggcaggtgggctgaaaaggag
ggcatcaagacagagaccaacggagcggcgccaccagcaccagcgccagtaaaggaggag
cccaagaaggacgagaggattctgatgaaggttctcgatgcgggtgaagtcaccacacaa
gagctcgatgcggccctaaagagaccatcacaaaaatcggccgacgccatcatgaagatt
attgtgccaatcatcgatgacgtacggaagaatggcgacaaggcacttctctcatacact
cacaagttcgaaagggcgacatctttgacctctccagtactcaaggcgccgttccccgag
tccatgatgcagcttcccgcggagaccatcagggccatcgacgtgtcattcgagaacatc
aagaagttccacgccgctcaaaaagacgagaagccgttgcaggtcgagaccatgcccggt
gttgtctgtagccgtttctctcgccctatcgaagccgttggcctttacgtgcccggtggt
accgccgttctgcccagcaccgcgctcatgcttggtgtaccggctatggtagccggctgc
cagaagattgtcattgcctcgccgcctcgctccgacggcagcatcacccctgagattgtt
tacgtcgcccacaaggttggcgctgagtcgattgtcctcgctggtggtgcccaggctgtt
gctgccatggcttatggcactgagagcgtgaccaaggttgacaagattctcggccctggt
aaccagttcgtcacggcggccaagatgtacgtcagcaatgacaccaacgccggcgtcggt
attgacatgcccgccggtccttccgaggtcttggttgttgccgacaaggacgccaaccca
gcatttgtcgcctctgatctcttgtcccaagctgagcacggcgtcgacagccaggtcatt
ctcattgctattgacctgactgatgcccagctcgctgctattgaagatgaggttcacaac
caggccatggccctcccgcgtgtggacattgtccgggggtctattgctcactcgctgact
gtcaaggtcaagactgtggaggaggcgatggagatcagcaacaggtatgcgcctgagcac
ttgattcttcagatcaaggacgcggagaaggcggtggagaaggtgatgaatgcggggagt
gtgtttattggggagtggacgcctgagagcgtgggtgattactcggctggtgttaaccac
tctttgcctacttatggcttcgccaagcaatactctggcgtgaatctcgcctcgtttgtc
aagcacattaccagctctaacctgacggctgaggggctgaggaatgtgggaggggcggtg
atgcagttggctaaggttgaggagctggaggctcacagacgggcggtggagattcggttg
gagcatatgaacaaggcttga

DBGET integrated database retrieval system