KEGG   Podospora anserina: PODANSg5862Help
Entry
PODANSg5862       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pan  Podospora anserina
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PODANSg5862
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PODANSg5862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 346 aa AA seqDB search
MSLFVASRSAFRVSAPLKRQIRSYATDPSPSSKGSNNTLLYGAAAAAGLAGAGYYFLSGS
TAANKAQEKVKNASAAVAEKIPGVEAKKAFTGGDQGFLSLKLEEVEIINHNSKRLRFRLP
EDDMVSGLPVASAILTKYKPVDAEKAVLRPYTPISDEDTPGYIDLLVKKYPNGPMSTHLH
DMAPGQRLDVKGPLPKYAWSPNKHEHIALVAGGTGITPMYQLLRTIFNNPEDKTKVTLVF
GNVSADDILLKNELATLENHYPQRFRAFYVLDNPPKQWTGAKGFINKELLKTVLPEPKNE
NIKVFVCGPPGMMDSISGNKKSPRDQGELKGILKELGYTPEQVYKF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgttcgtcgctagtcggtccgccttccgggtctctgcgcccctcaagcgccaa
atccgcagctacgccaccgacccctccccctcctccaagggcagcaacaacaccctcctc
tacggcgccgccgccgccgccggtctcgccggtgcaggctactacttcctctccggctcc
accgctgcgaacaaggcccaagaaaaggtcaagaacgcctccgccgccgtcgcggagaag
atcccgggcgtcgaggccaagaaagccttcaccggcggcgaccagggcttcctcagcctc
aagcttgaggaggtggagatcatcaaccacaactcgaagcgtcttcgtttccgcctgccc
gaggatgacatggtctctggccttcctgtcgcgagtgccattttgacaaagtacaagcct
gtggatgccgagaaggctgttttgaggccgtacacgccaatcagcgacgaggacacgccg
gggtatattgatttgttggtgaagaagtaccccaatggcccgatgagcacccatttgcac
gatatggctcccggtcagaggcttgatgtgaaggggccgctgccaaagtatgcttggtcg
ccgaacaaacatgagcatattgctcttgtggctggtggtacggggatcacgcccatgtac
cagctgctcaggaccatcttcaacaaccccgaggataagaccaaggttaccttggttttt
ggcaacgtcagcgcggatgatatcttgttgaagaacgagctggccacgctcgagaaccac
taccctcagcggttcagggcgttttatgtcttggacaacccgcccaagcagtggactggt
gcgaaggggttcatcaacaaggagctgctgaagactgtgttgccggagccgaagaacgaa
aacatcaaggtttttgtttgcgggccgccggggatgatggacagcatttcggggaacaag
aagagcccgagggaccagggggagttgaaggggattttgaaggagttggggtatacccct
gagcaggtttacaagttttga

DBGET integrated database retrieval system