KEGG   Podospora anserina: PODANSg5952Help
Entry
PODANSg5952       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pan  Podospora anserina
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:pan00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 773 aa AA seqDB search
MATTAPQGTLRQRSVAGSKKNKDGASSDVELDKLVKAANQRPKAVSENDHRIAFFIITIL
AFITRFWGISHPNEVVFDEVHFGKFASYYLEKTYFFDVHPPFGKLLFAFVGWLVGFDGHF
HFENIGDSYIANKVPYVAFRSLPALLGALTVSVVYLIMWESGYSLPACILAAGLVLLDNA
HIGQTRLILLDATLVFAMACSLLCYIKFYKLRHEPFSRKWWKWLILTGFALSCDISTKYV
GLFAFITIGSAVVIELWDLLDIKRPGGALTLAQFGKHFAARAFGLIFLPFLFYLFWFQVH
FTILTRSGPGDDFMTPEFQETLSDNIMLSNAITIDYYDTISIKHKETKAYLHSHPERYPL
RYDDGRVSSQGQQVTGYPFNDTNNYWQILPAGADDKQLNRHIKNHDLIRLRHVVTDTILL
SHDVASPYFPTNQEFTTVSLADAYGDRAADTLFEVRIEHGKPNQEWKTISGHFKLIHNPS
KVAMWTHTKPLPEWAFKQQEINGNKQIAPSSNVWLVEDISSLPANHPRRAKVAKKVKTLP
FLRKWFELQRSMFWHNNQLTASHPYASLPYSWPFLLRGVSFWTQNDTRQQIYFLGNPIGW
WIASSVLAIYAGIILADQFSLRRGMDALDHRSRSRLYNSTGFFFLAWATHYFPFYVMGRQ
LFLHHYLPAHLASALVTGALVEFIFSQDAVEHEVAHQAAKAGKKSQTPKHHLTARERFAG
QSLFGSWVATGVILTLVAAGWYFFLPLTYGYPGLTVEQVIRRKWLGYDLHFAK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggctacaacagccccccagggcaccttgcgccagcgtagcgtagctggtagcaagaag
aacaaagatggcgcctcctccgatgttgagctcgacaagctcgtcaaggccgccaaccag
cgcccaaaggctgtctcggagaacgatcacaggatcgccttcttcatcatcaccatcctg
gccttcatcaccagattctggggcattagtcaccccaacgaggttgtttttgacgaagta
cacttcggaaagttcgcctcgtactatctcgaaaagacctacttcttcgacgtgcaccct
ccgttcggcaagctcctctttgcctttgttggctggctggttggcttcgatggccacttt
cacttcgagaacattggcgactcctacattgcgaacaaggttccctacgtggccttccgc
tccctccctgccctccttggcgccttgaccgtctcggtggtataccttatcatgtgggag
tctgggtacagccttcccgcctgcattcttgccgctggcttggttctgctcgacaacgcc
catattggccaaacacgcctgattcttctcgatgccaccctcgtgtttgccatggcctgc
agcttgctctgctatatcaagttctacaagttgcgccatgagcccttctcaaggaagtgg
tggaagtggctgatcctcactggatttgccctttcctgcgatatctcgaccaaatacgtt
ggtcttttcgccttcatcaccattggttctgctgttgtcattgagctttgggacttgctg
gatattaagaggcctggtggagctctgaccttggctcagttcggcaagcactttgctgct
agagctttcggcttgatcttcctgcccttcctcttttacctcttctggttccaggttcac
ttcaccattctcacccgctccggccccggtgatgatttcatgacccccgagttccaggag
accctgagcgacaacatcatgctcagcaacgccatcaccattgactattacgacaccatc
tctatcaagcacaaggagaccaaggcttaccttcacagccacccggagcgttatcctctg
cggtatgacgatggtcgtgtttccagccagggtcagcaggtcactggttacccattcaat
gacaccaacaactattggcagattctccccgctggtgccgatgacaagcagctcaatcgt
cacatcaagaatcacgacctcatcagactccgtcacgttgttaccgacaccattctcttg
tcccacgacgttgcctcgccatacttccctaccaaccaggagttcaccacagtctcactt
gcggacgcctatggtgacagggctgctgacactctcttcgaagtacgcattgagcatggc
aaacctaaccaggaatggaagactatctcgggccacttcaagctgatccacaacccaagc
aaggttgccatgtggactcacaccaagcctcttcccgaatgggctttcaagcagcaagaa
atcaacggcaacaagcaaatcgcaccaagttccaatgtctggcttgttgaggacatttct
tctctgcccgccaaccacccgcgccgcgccaaggtagcaaagaaggtcaagactttgccc
ttcttgcgcaagtggtttgagctgcaaaggtccatgttctggcacaacaaccagctgacg
gccagccacccctacgcttcgcttccctactcttggcccttcctgctccgcggtgtcagc
ttctggacacagaatgatactcgtcagcaaatctacttccttggcaacccaatcggttgg
tggattgccagcagtgtcctggccatctatgccggcatcatcttggccgaccagttctca
ctgcgccgtggcatggatgctttggatcaccgttctcgctcccgcctgtacaactccacg
ggcttcttcttccttgcctgggctacccattacttccccttttatgtcatgggtcgtcag
ctcttccttcatcactatctccccgcacatctagcatctgcccttgtcacgggtgcgctg
gttgagttcatcttcagccaggacgccgtggagcacgaggtggcccatcaagccgctaag
gccggcaagaagagccagactcctaagcaccacttgacggcccgcgagcgttttgccggc
cagagtttgttcgggtcatgggttgccaccggtgtcattctcaccttggttgccgcgggc
tggtacttcttcttgcctttgacctacggctaccccggcctgacggtggagcaagttatc
cggagaaagtggctgggttatgatcttcactttgccaaatag

DBGET integrated database retrieval system