KEGG   Podospora anserina: PODANSg6031Help
Entry
PODANSg6031       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pan  Podospora anserina
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PODANSg6031
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODANSg6031
   00020 Citrate cycle (TCA cycle)
    PODANSg6031
   00620 Pyruvate metabolism
    PODANSg6031
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PODANSg6031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 459 aa AA seqDB search
MLVPVLRRQAVQHVRLARVALPSLTRWYASYPPHTVVKMPALSPTMTAGNIGAWNKKPGD
SIAPGEVLVEIETDKAQMDFEFQEEGVLAKVLKDTGAKDVAVGNPIAILVDEGTDISAFE
SFSLEDAGGDASAPAPKKEQKSESESSAPTPAPTPAPEPESTGPSGRLEPALDREPNISA
AAKRLAIENGISIKGLKGTGPGGKITEEDVKKAQSSPAAAGAASAASYQDTPISGMRKSI
ASRLQSSIVDNPHYFVSSSLSVGKLLKLRQALNSSAEGRYKLSVNDFLIKAIAVASKKVP
AVNSSWRDGVIRQFNNVDVSVAVATPTGLITPIVTNVESKGLETISASVKELAKKARDNK
LKPEEYQGGTITISNMGMNAAVERFTAIINPPQAAILAVGSTQKVAVPVENEDGTTGVEW
EERIVVTGSFDHKVVDGAVGAEWMREFKKVIENPLELLL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttcccgtcctcagaaggcaagctgttcagcatgtccgccttgcccgcgtcgcc
cttcccagcctgacaagatggtacgcttcgtaccccccgcacaccgttgtcaagatgccc
gccttatctcctaccatgacggcgggaaatatcggcgcctggaacaagaagcccggtgac
agcatcgcccccggcgaggtcctcgtcgagatcgagaccgacaaggcccagatggacttt
gagttccaggaggagggtgttttggccaaggtcctcaaggacacgggcgcgaaggatgtc
gctgttggcaatccaattgccatcttggtcgacgagggaaccgacatcagtgcctttgag
agcttctcgctcgaggatgccggtggtgatgcttcggccccggctcccaagaaggagcag
aagtccgagtccgagtcttccgcccctaccccggcgcccactccggcccccgagcccgaa
tcgaccggacccagcggcaggctcgagcctgccctcgatcgcgagcccaacatctctgcc
gccgccaagaggcttgctattgagaatggtatctcgatcaagggcctcaagggtactggc
ccgggtggcaagatcaccgaggaggatgtcaagaaggcccagtcctcccctgccgccgcc
ggtgctgcatctgctgcctcttaccaggacacccctatcagcggcatgcgcaagtccatc
gcttcgcgtctccagtcctctattgttgacaacccccactactttgtctcttccagcctc
tccgtcggcaagctcctcaagctccgccaggctctcaacagctctgccgagggccggtac
aagctttccgtcaacgacttcttgatcaaggccattgccgttgcctccaagaaggtcccc
gccgtcaacagctcgtggcgtgatggcgtcattcgccagttcaacaacgtcgacgtttcc
gtcgccgtcgccacccccaccggcctgatcacccccatcgtcaccaacgtcgagtctaag
ggtctggagaccatctcggcttccgtcaaggagcttgccaagaaggctcgtgataacaag
ctcaagcccgaggagtaccagggcggcaccatcaccatctccaacatgggcatgaacgcc
gctgtcgaacgtttcaccgccatcatcaacccccctcaggctgccatccttgctgtcggc
agcacccagaaggttgccgtcccagtcgagaatgaggatggcaccacgggcgtcgagtgg
gaggagcggatcgtcgtcactggcagcttcgaccacaaggtcgttgacggtgccgtcggt
gccgagtggatgcgcgagttcaagaaggtcattgagaaccctcttgagcttcttctttaa

DBGET integrated database retrieval system