KEGG   Podospora anserina: PODANSg6174Help
Entry
PODANSg6174       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pan  Podospora anserina
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PODANSg6174
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PODANSg6174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 323 aa AA seqDB search
MSSQIPHITILGSLNTDLVAYVPHHPLPGETLTATSFLTSPGGKGSNQAVACAKLSRPRD
LSSPSAHVSMVGAVGSDSNGDLLLSNLATHGVDSSLVTKLPNKKTGIAMIVVEAETGQNR
IIISGEANHQVGEEYVTQGGWLDKTDLLIMQLEIPMGTVLKAVEEAKRRGVDVLLNPAPA
KILPDGVYDGLRHLVVNETEAAILGGVEEKELDTLEGLERVGKGFVGKGVENFIATLGGR
GVFYLTKGGRSGLIEAEKGVKVVDTTGAGDTFVGRYALEAARARKEGGEFDVGGAVGRAN
KAAAVTVTREGAARSIPWRDEVE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccaaatcccccacataacaatcctcggctccctcaacaccgacctagtagcc
tacgtcccccaccaccccctcccaggcgaaaccctaaccgcaacctccttcctcacctcc
ccaggcggcaaaggttccaaccaagccgtcgcctgcgccaagctctcccgcccccgcgac
ctctcctccccctccgcccacgtctccatggtcggcgccgtaggctccgactccaacggc
gaccttttgttgtctaacctcgccacccacggggtcgactcctccctggtaaccaaactc
cccaacaagaaaactggcatcgccatgatcgtcgtggaggcggaaacaggccaaaacaga
atcatcatctccggagaggcgaaccaccaagtaggggaggagtacgttacacaggggggg
tggttggacaagaccgatttgttgatcatgcaactcgaaattccgatggggactgtactc
aaagcggtggaggaggcgaagagacggggggtggatgttttgctcaatccggccccggcg
aagattctgccggatggggtttatgacgggttgaggcatttggttgttaatgagacggag
gctgccattcttgggggggttgaggaaaaggagctggatacgctggaggggttggagagg
gttgggaaagggttcgtggggaagggggtggagaattttattgctacgcttggggggagg
ggggtgttttacttgaccaaggggggaaggagtgggttgatcgaggctgagaagggggtc
aaggttgttgatactactggggcgggggatacgtttgtggggaggtatgcgcttgaggct
gcgagggcgaggaaggaggggggggagtttgatgttgggggggcggtggggagggcgaat
aaggcggcggcggtgacggttacgagggagggggcggcgaggagcattccttggagggat
gaggttgagtag

DBGET integrated database retrieval system