KEGG   Podospora anserina: PODANSg6197Help
Entry
PODANSg6197       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pan  Podospora anserina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PODANSg6197
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PODANSg6197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 623 aa AA seqDB search
MPSISNLALAGLLAAGQGASASLVGAIQLEKFIKQETPIALQAVLDNIGPDGIKVPGAGR
GLVIASPSTSDPDYFFTWTRDAALTFRTLIDDFVFGNKALEPLINDYIYGQARLQTVSNP
SGTLLPNGAGLGEPKYMKDGSRYNGNWGRPQRDGPPLRAISLIQYSNYLVSKGQKARVKD
EIWPIIANDLAYVGQYWNSTGFDLWEEVNGASFFTTQAQYRSLVEGEALAKVLGLPCTAC
TEAPQVLCFLQSYWNGKFITANFIQGNHNRGGVDANTVLGPLVAFDPYAPCDSPSLQPCH
PRMLANFKNFVDTFRDPALYPINKGIPQNKGIALGRYPEDIYYNGNPWYLITLGSAEYLY
AAIASWEKSGGITITPTSLPFFKDLYPLARVGTFGKLHPAYYLIKGLVKTYADSFVAVSQ
KYTPKDGMMAEQFLKVEPFTPISARNLTWSFAAFVGMNHRRQGHLPPSWVPKNVKVPDVC
VGTSVKGTYAPATQAGAPNVTIPCISNVLFQLNASTYYGENLYVVGNSPTLGSWDLETAY
PLMSSRYTDERPLWFATIPLEMEEGVSTLRYKYARQQDCGQEWIVEEEERVLEVPACVKD
GSEEVLAERDEAFNGPAGSPGGC
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgccttccatctcaaatcttgcgctggctggccttttggctgctggccagggggctagt
gcttcgctcgttggggctattcagttggagaagtttatcaagcaggagacccccattgct
ctccaggctgtcctcgacaacatcggccccgacggaatcaaggttcctggtgctggacgc
ggtcttgtgattgctagcccgtctacttccgatcctgattacttcttcacctggactcgt
gacgcggccttgactttcaggacgctgattgatgatttcgtgtttggaaacaaggctctt
gagccgttgatcaacgattatatctacggtcaggctcgtctccagactgtgagcaaccct
tcggggacgcttttgcccaacggtgctgggttgggtgagccgaagtatatgaaggatggt
tcgaggtataatgggaactgggggcgtcctcagcgcgatgggcctcctttgagggctatt
tcgttgattcagtactcgaattaccttgtctcgaaggggcagaaggcgagggtgaaggat
gagatttggcccatcattgctaatgatctggcttatgttggacagtactggaactccact
ggcttcgacctctgggaggaggtgaacggtgcctcgttcttcaccacccaggctcagtac
cgctctctcgtcgagggcgaggcccttgccaaggtcctcggtctcccctgcacggcctgc
accgaggctccccaggtcctctgcttcctccagtcctactggaacggcaagttcatcacc
gccaacttcatccagggcaaccacaaccgcggcggcgtcgacgccaacaccgtcctcggc
ccccttgtcgcctttgacccttatgccccctgcgactcccccagcctccagccttgccac
cctcgcatgctggccaacttcaagaactttgtcgacaccttccgtgacccggccttgtac
cccatcaacaagggcatcccccagaacaagggcatcgctctcggtcgctacccggaggac
atttactacaacggtaacccctggtacctcatcaccctcggttccgccgagtacctctac
gccgccatcgccagctgggagaaatccggcggcatcaccatcacccccacctccctcccc
ttcttcaaagacctctaccccttggctcgcgtcggcacctttggcaagctccatcccgcg
tactacctcatcaagggcctagtcaagacctacgccgactccttcgttgccgtctcccaa
aagtacacccccaaggacggcatgatggccgagcagttcctcaaggtcgagcccttcacc
cccatctccgccagaaacctcacctggtcttttgccgcctttgtcgggatgaaccaccgc
cgacagggccacctccctccctcgtgggtccccaagaatgtcaaggtccctgatgtctgc
gttggtacctctgtcaagggcacctacgcccctgccacccaggctggtgctcccaatgtt
actattccttgcatctccaacgttctgttccagctcaatgcctcgacgtattatggcgag
aacctttatgttgtgggcaactcgcccacgctgggtagctgggatttggagacggcgtac
ccgctgatgagcagcaggtatactgacgagaggccgctttggttcgccaccatcccgctt
gagatggaggagggtgtgtccacgctgaggtacaagtatgccaggcagcaggattgcggg
caggagtggattgtggaggaggaggagagggtgttggaggtgccggcttgtgtgaaggat
gggagtgaggaggttttggcggagagggatgaggcttttaacgggcctgctgggtctcct
ggcggttgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system