KEGG   Podospora anserina: PODANSg6306Help
Entry
PODANSg6306       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
pan  Podospora anserina
Brite
Exosome [BR:pan04147]
 Exosomal proteins
  Proteins found in most exosomes
   PODANSg6306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 97 aa AA seqDB search
VSPSEITSIISILNETDKSNGPAATKAFAEGIHVGGERYVATRNEDRHVYGRQGRTGICI
VKTKQAILVGHYGENAQAGNATQTVEALADYLIGLGY
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtctctccctcagaaataacctccatcatctccatcctcaacgaaaccgacaagtccaac
ggccccgccgccaccaaggccttcgccgagggcatccacgtcggcggagagcgctacgtt
gccacccgcaacgaggaccgccacgtctacggccgccaggggaggacgggcatctgcatc
gtcaagaccaaacaggccatcctcgtcggccactacggcgagaacgcccaggccggcaac
gccacccagacggtcgaggcgctggctgattacctgattggtcttggttattaa

DBGET integrated database retrieval system