KEGG   Podospora anserina: PODANSg6332Help
Entry
PODANSg6332       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 736 aa AA seqDB search
MDVDQDVVMDGTADAPSIQSANGYSEPTSKSGGSSLETPNGHSADSSAEGTSSKSGEPGY
PERFRRKGILPTGCCYDDRMKLHANADFGPNPHHPEDPSRIEVIMRIFKKHGLLFTGTDA
ELIDVINNRPTSYMWRIPAREATEEEIRTVHRVEHFNWVKALSTKTTHELRDISAMMDQG
RESLYVGSMTYEASLISAGGAIETCKAVVTGTVKNAFAVIRPPGHHAEYDQPMGFCLFNN
VPIAAKVCQKEYPDICRRVMILDWDVHHGNGIQNMFYEDPNILYISLHVYKNGDFYPGKP
DNPMIPDGGMEQCGAGNGLGKNINIAWHDQGMGDGEYMAAFQKIVMPIGHEFNPDLVIIS
AGFDAAAGDELGACFVSPACYAHMTHMLMSLAGGKVAVCLEGGYNLIAISKSALAVAQTL
MGEPPPQMQIPRISKEASKVLAKVQAYQAPYWECMRPGIIDVTEMTKNDSSRLHDVIRSS
QKEKLSKYGMLPLYIQRDIIFRSFENQVLVTKGVQSAKKLLLIVHDPPELHGQPDPLDNS
LEPHNSWVSDGVAKYIDWACNNDFGVIDINVPHYITRTDDTEHFTPRMDEKTLQMHLQEL
MCYIWDNYLQLYDGADEIYLMGVGNAYLGIKVLLINRINFVDGSLRPVKSDVDEDLSSWY
KDNSQVYVANDHACWSDPDLTRKVMKRRFGNAIRSEVNGLAPMMDRHFKDVLRFIAEQAR
KLHGGETTEDEGNRRG
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgaccaagatgttgtgatggatgggaccgcggatgcgccttctatacagtcc
gccaatggctactcagaaccaacgtccaagtcgggagggagctctctggagacaccaaac
ggccacagcgccgacagcagtgccgaagggacatcttccaagagtggcgagcctggctat
cctgaacgtttccgacgaaaagggatcctaccaaccggttgctgttacgatgaccgcatg
aagctccatgccaacgcggatttcgggccaaaccctcaccacccagaagacccatcgcgt
atcgaggtcattatgaggatcttcaaaaagcacggtctcctgtttacgggaacagatgcc
gagctcatcgatgtcattaacaacagaccaaccagctacatgtggaggattcctgcaagg
gaagcgacagaagaagagatccgtactgttcatagagtcgaacatttcaactgggtcaag
gctctgtccaccaagaccacgcacgaactccgcgatatctcagccatgatggaccaaggt
cgtgagtccctctatgttggtagtatgacatacgaggcctctctgatctcggccggtggt
gccatcgaaacctgcaaggctgtcgttaccggcaccgtcaagaatgccttcgctgttatc
cgaccaccaggacatcacgccgagtacgaccagcctatgggtttctgtttgttcaacaac
gtaccgattgcggccaaagtctgccagaaggagtaccccgacatttgccgccgcgtcatg
attctcgattgggatgtccaccacggcaacggcattcagaacatgttttacgaggatccc
aacattctctacatatctttgcatgtttacaagaacggagacttttacccaggaaagcct
gataaccccatgattccggatggcgggatggagcaatgcggtgctggaaacgggctcggc
aagaacatcaacatcgcgtggcacgaccagggcatgggcgatggcgagtacatggcggca
ttccaaaagattgttatgccaattggccacgagttcaaccccgacctggttatcatttct
gccggtttcgatgctgccgccggagatgagctcggcgcttgcttcgtgtcgcctgcctgt
tacgctcacatgacacacatgttgatgtctctggcgggcggcaaggttgccgtttgtttg
gagggtggttacaatctgattgccatctccaaatcggccctggctgtcgctcaaaccctc
atgggcgaaccacccccgcagatgcagattccaagaatcagcaaggaagccagcaaagtc
ctggccaaggtccaagcttaccaggctccctattgggagtgcatgcggccgggcatcatc
gacgttacagagatgaccaagaacgactcgtctcgcctgcacgacgtgatcagatcatca
caaaaagagaagttatccaagtacggcatgctcccgttgtatatccaacgagacatcatc
tttaggtcatttgagaaccaagtgttggtgacgaagggcgtgcagtccgcgaagaagctg
ctgttgattgtacatgaccctcccgagctgcatgggcagccggatccccttgataactct
ctcgagccacacaattcttgggtctctgatggtgtggccaagtacattgactgggcttgc
aacaatgactttggggtgattgatatcaacgtcccccactacattacccgaacagacgac
acggagcacttcacgccgagaatggacgagaagactctccaaatgcatcttcaagagctg
atgtgttacatctgggacaactacctccagctctacgacggggcagacgagatctacctg
atgggggtgggtaatgcctacctcgggatcaaggtcctgttgatcaacagaataaacttt
gtggacggcagtctccggcctgtcaagtcggacgtggacgaggacttgtcgtcatggtac
aaggacaactcacaggtctatgttgccaacgaccacgcctgctggtcggacccggatctt
actaggaaggtgatgaagaggcggttcgggaatgccatcaggagcgaggtgaatgggttg
gcgccgatgatggataggcattttaaggatgtgctgcggtttattgctgagcaggcgagg
aagcttcacgggggggagacgacggaggatgaggggaataggagggggtga

DBGET integrated database retrieval system