KEGG   Podospora anserina: PODANSg6385Help
Entry
PODANSg6385       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pan  Podospora anserina
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PODANSg6385
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PODANSg6385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 594 aa AA seqDB search
MLRLTAALSLAGVVSASFENNLAYLSPSRRHASLAVPLAHVQKRQSGSLYTAAEVNFTHG
IASGDPYANSVILWTRLSPTADNVASDIVPEGVVPIYGDEGAPPSSRAACVEYRIGTDEA
LTNVVNSGRAYTSSEVDWTVKFEATNLQPFTTYFYRFNVCDSSKSSVVGRTKTIPTKDQT
VPRNIKLAVYSCSNYPEGYFNAYAAVNAKDSADYILHLGDYIYEYKAGLTDLRKPLPDRE
TYSLYDYRKRTASYRLDPDLALSHQKFPWIPVWDDHEVADNSYKDGSKNSDGEEFRLRKQ
AAVRSYFEWMPLRQVTMDDSLRIWRDFSIGNLFDLIMLDTRQYNRDVTVLGPLGGIIGGN
KNEVEEQADWVNRTIMGFNQEAWFYTKLQESSDRQARWRLVGNQVIFSRVTIGVFNDEPF
NLDQWDGYIANRDRVYKTLVDNKINNTVMLSGDSHAAWVSDMVWKAEEGYDENTGAGAVG
VELAGSAVSSSSPLTGIVPRLITDPISKLLIKNNPTLQWQDLYYRGYFEMDIGYDAIEAQ
FFGIPNLKKRSTEEIKIAKFLIRDGENKLARNPTVGGGVAYAGALKNGKVEKAP
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcctcacagctgccctctcccttgcgggtgttgtctctgcttctttcgagaac
aacctcgcctacctctcaccatctcgtcgccacgcctctctcgctgtccctcttgcccac
gttcagaagcgccagagtggctctttgtacacagcagcggaagtgaacttcacccacggc
atcgcgtcaggagatccatatgccaactccgttattctctggaccagactttcccccaca
gccgataacgtcgcctcagatatcgtcccagagggcgtagtgcccatctatggcgatgag
ggcgccccccccagcagccgcgccgcctgcgtcgagtaccgcattggcacagacgaagcc
ttgaccaatgtcgtaaacagcggcagagcctacacctcgagcgaagtagactggacagtc
aagtttgaagcaacaaacctccaacccttcacaacctacttttaccgcttcaacgtctgc
gactcctccaaatcctccgtcgtcggccgcacaaagaccatccccacaaaagaccaaacc
gtcccccgcaacatcaagctagcagtctactcctgctccaactaccccgaaggctacttc
aacgcctacgccgccgtcaacgccaaggattccgcagattacatcctccacctcggcgat
tacatctacgagtacaaagccggcctcaccgacctccgcaaacctcttcctgaccgggag
acttactctctctacgattaccgcaagcgcacagcttcctaccgtctcgatcctgatctt
gccttgtctcaccaaaagttcccttggatccctgtctgggatgaccacgaggtcgctgac
aacagttacaaggacggctccaagaacagcgacggggaggagttcaggttgaggaagcag
gcggctgtgaggtcgtattttgagtggatgccccttcggcaggtcactatggatgactct
ttgcgcatctggcgggatttctccattgggaacttgtttgatctcatcatgcttgacacg
aggcagtacaaccgggacgttaccgttcttgggccgctgggggggattattggggggaat
aagaatgaggtggaggagcaggctgattgggtgaacaggacgatcatggggttcaaccaa
gaggcttggttctacaccaagcttcaggagtcgagtgatcgacaggccaggtggaggttg
gtgggcaaccaggtgatcttcagcagggtgacgattggagtttttaatgatgagccgttt
aatctggatcagtgggatgggtacatcgcgaatagggacagggtgtacaagacactggtg
gacaacaagatcaacaacacggtcatgctgagcggggatagccatgcggcttgggtgagt
gatatggtttggaaggcggaggaggggtatgatgagaacaccggggcgggggcggtgggg
gttgagttggcggggagtgcggtgagcagctccagtccgttgacggggattgtgccgagg
ttgatcacggatccgatttccaagttattgatcaagaacaacccgacgttgcagtggcag
gatttgtattataggggatattttgagatggatattgggtatgatgctattgaggcgcag
ttctttgggattccaaatctcaagaagaggagtacggaggagatcaagattgcaaagttc
ttgatcagggatggggagaataagttggcgaggaaccctactgtgggtggtggagtggcg
tatgcgggcgcgttgaagaatggcaaggtcgagaaggcaccttga

DBGET integrated database retrieval system