KEGG   Podospora anserina: PODANSg6407Help
Entry
PODANSg6407       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PODANSg6407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 295 aa AA seqDB search
MATSTLGLIPNWYPPTRENYDLILSLWKWFPAFASLQWATTWYGMGKTSLPSPLNLPGRL
AWLTMESPGFLTLLYTFFRLPPQLSVTDLPWQNSVLAGLFVIHYSYRAILFPLLQPSMAP
MHLSIWASAFSFQVINGLMLGSWLGGYGPTSQEDWDNLLPFGTLQFSVGIAIFYVGLAAN
YYHDDELREIRRRENHRQDRLVKEGRVKRGDVSRHYEVPKAGLFKYMLYPHYFVEWVEWF
GYWTAAGYGCVPARCFLFNEVASMLPRAVRGKAWYVEKFGEEKVGKKWAVIPGVW
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcaacattgggtctcataccaaactggtacccccccacccgcgaaaactac
gacctcatcctctccttgtggaagtggttccctgccttcgcctccctccaatgggcaaca
acctggtacggcatgggcaaaacctccctcccctccccgctcaacctgcccggccgtcta
gcctggctaacaatggaatcccccggcttcctcaccctcctctacaccttctttcgtctc
cccccgcaactttccgtcaccgacctcccctggcaaaactccgtcctcgccggcctcttc
gtaatccactactcctaccgcgccatcctcttccccctcctccaaccatccatggcacca
atgcacctctccatctgggcctcggccttctccttccaagtcatcaacgggctcatgctc
gggtcctggctaggcgggtacggaccaacctcccaagaagactgggataacctcttgccg
tttggaacactgcagttcagcgttggcatcgcgattttttacgtggggctggcggcgaat
tactatcatgatgatgagctgagggagataaggaggagggagaaccatcgccaggatagg
ctggttaaagaaggcagggtgaagaggggggatgtgagcaggcattatgaggttcccaag
gcgggcttgttcaagtacatgttgtatccgcattactttgtcgagtgggtcgagtggttt
gggtattggactgcggcggggtacgggtgtgtgccagcgaggtgcttcttgttcaatgag
gttgcgtcgatgttgcccagagcggtgagggggaaggcctggtatgttgaaaaattcggg
gaggagaaggtggggaagaagtgggcggttattccgggggtttggtag

DBGET integrated database retrieval system