KEGG   Podospora anserina: PODANSg6413Help
Entry
PODANSg6413       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
pan  Podospora anserina
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PODANSg6413
   00240 Pyrimidine metabolism
    PODANSg6413
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PODANSg6413
   03410 Base excision repair
    PODANSg6413
   03420 Nucleotide excision repair
    PODANSg6413
   03430 Mismatch repair
    PODANSg6413
   03440 Homologous recombination
    PODANSg6413
DNA repair and recombination proteins [BR:pan03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      PODANSg6413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 176 aa AA seqDB search
MPPRRSTRATTKAASQSKLNFSNKITKPLPSRPNQKDKAVKLEEAITRTATPSPPPSSEP
APEQELSPAEVKAAKVSQAAINRYWKRIEDSRLAKEVHKKHGTGLGTGEKLLRYFDVSSQ
FGPCVGITRLERWQRAERLGLNPPIEVLAVIVKEGRGEEKAHLDQLLSSTAIGERE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccaccccgccgctccacccgagcgacaaccaaggccgccagccaatccaagctgaac
ttctccaacaaaatcaccaaaccgctcccctcccgccccaatcaaaaagacaaggctgtc
aagcttgaggaagccatcacaagaacagccaccccctcccctcccccctcctccgagcca
gctcctgaacaagaactttcgccggcagaggtcaaggcggcaaaggtttcgcaggcggcg
attaatcgttactggaagaggattgaagactcgaggctggcgaaggaagttcacaagaag
catgggactgggttggggacgggggagaagcttttgaggtattttgacgttagcagtcag
tttgggccatgtgtggggattacacgactcgagaggtggcagagggcggagaggctgggg
ctcaacccgccgattgaggtgctggcggtgattgtcaaggaggggaggggggaggagaag
gcgcatttggatcagttgttgagtagtactgcgattggggagagggagtaa

DBGET integrated database retrieval system