KEGG   Podospora anserina: PODANSg6577Help
Entry
PODANSg6577       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pan  Podospora anserina
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PODANSg6577
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODANSg6577
   00620 Pyruvate metabolism
    PODANSg6577
   00640 Propanoate metabolism
    PODANSg6577
  Energy metabolism
   00680 Methane metabolism
    PODANSg6577
Enzymes [BR:pan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PODANSg6577
Lipid biosynthesis proteins [BR:pan01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PODANSg6577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 634 aa AA seqDB search
TGTAGLEEYQKLYKESITEPKKFWGRLARELLTWSKDFQTVHSGSLAGGDNAWFLEGELN
ASYNCVDRHAFKDPNKVAIIYEADEPSDGRNVTYGELLRDVSKLAHVLTQMGVRKGDTVA
IYLPMIPEAIVALLACSRIGAVHSVVFAGFSADSLRDRVIDGGSKVVITTDEGKRGGKLI
GTKKIVDEALKQCPDVGHVLVYKRTGADIPMTEGRDFWWHEEVEKWPSYYPPVAVNSEDP
LFLLYTSGSTGKPKGVMHTTGGYLLGAATTGKYVFDIHDGDRYFCGGDVGWITGHTYVVY
APLLLGVSTVVFEGTPAYPNFSRYWDIIEQHKVTQFYVAPTALRLLKRAGNQHVRNEMKH
LRVLGSVGEPIAAEIWKWYFEVVGKEEAHIVDTYWQTETGSNVITPLAGVTPTKPGSASL
PFFGIEPAIVDPVSGEEIHGNDVEGVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYF
TGDGAGRDHEGFYWIRGRVDDVVNVSGHRLSTAEIEAALIEHASIAEAAVVGVADELTGQ
AVNAFVSIKNGAEVDDALRKDFILQVRRSIGPFAAPKAVFVVPDLPKTRSGKIMRRILRK
ILAGEEDQLGDISTLSDPSVVEKIINIVHEGKKK
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
accggtaccgcaggtctcgaggaatatcagaaactctacaaggaatccatcaccgaaccc
aagaagttctgggggaggctggcgcgtgagctcctgacctggtctaaggatttccagact
gtccacagcggctccctcgccgggggtgacaatgcctggttcctggagggtgagctcaat
gcgtcatacaactgtgtcgatcgccatgccttcaaggaccccaacaaggtcgccatcatc
tacgaagccgacgagccctcggacggccggaacgtcacctacggcgagctcctgcgcgat
gtctccaagctcgcccacgtgctcacccagatgggcgtgcgcaagggcgacaccgtggcc
atctacctgcccatgatcccggaggctatcgttgcccttcttgcttgcagcagaatcggc
gccgttcactcggtggtctttgccggtttctcggccgactcgcttcgcgaccgtgtcatc
gatggcggttccaaggtggtcatcaccaccgacgagggcaagcgtggtggaaagttgatt
gggacaaagaagattgtcgatgaggctctcaagcagtgccccgatgtcggccacgtgctt
gtgtacaagcgcaccggcgccgacatccccatgaccgagggtcgcgatttctggtggcac
gaggaggttgagaagtggccctcatactacccccccgtggccgtcaactcggaggaccct
ctcttcctcctctacacctccggctctaccggcaagcccaagggtgtcatgcacaccacc
ggcggttatctcctgggcgccgccaccaccggaaagtatgtgttcgacattcacgatggc
gacaggtacttctgcggcggtgatgtcggctggattaccggtcacacctatgtcgtctac
gccccactcctcctgggtgtgtccaccgtcgttttcgagggtacacccgcctaccccaac
ttttccagatactgggatatcattgagcaacacaaggtcacacagttctatgttgctccc
actgccctgcgtctcctgaagcgcgccggcaaccagcatgtgcgcaacgagatgaagcac
ctcagagttcttggctccgtcggtgagccaatcgccgccgagatctggaagtggtacttt
gaggttgttggcaaggaggaggctcacattgtggacacgtactggcaaaccgagaccggc
tccaacgtcatcacccctcttgctggtgttactcccaccaagcccggctccgcctctctt
cccttcttcggcatcgagcctgcgatcgtcgaccctgtctctggcgaggagatccatggc
aacgatgtcgagggtgtccttgccttcaagcagccctggccaagcatggctcgcaccgtc
tggggcgcccacaagcgctacatggacacttacctgaacgtgtacaagggctactacttc
acgggcgatggtgccggtcgcgatcacgagggcttctactggatccgtggccgtgttgat
gacgttgtcaacgtcagcggtcaccgtctcagcacggctgagatcgaggccgccctcatt
gagcacgcctccattgccgaggcggccgtcgttggggttgccgacgagctcaccggccag
gctgtcaacgcctttgtgtccatcaagaacggcgccgaagtcgatgatgccctccgcaag
gacttcatcctccaggtccgcaggagtattggccccttcgcggcgcccaaggccgtgttt
gttgtcccagatcttcccaagacccgcagcggcaagatcatgagacgtattctcagaaag
attcttgccggtgaggaggaccagcttggcgacatcagcactctctcggacccatctgtt
gttgagaagatcatcaacattgtgcacgagggcaagaagaaataa

DBGET integrated database retrieval system