KEGG   Podospora anserina: PODANSg6593Help
Entry
PODANSg6593       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pan  Podospora anserina
Pathway
pan00010  Glycolysis / Gluconeogenesis
pan00052  Galactose metabolism
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
pan01130  Biosynthesis of antibiotics
Module
pan_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODANSg6593
   00052 Galactose metabolism
    PODANSg6593
Enzymes [BR:pan01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PODANSg6593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 6193722
NCBI-ProteinID: XP_001909557
UniProt: B2B0W5
Position
3
AA seq 401 aa AA seqDB search
MRLSLLPLGAFLLATPTLSVPSFTGEPDSSGKYWLFAPGITASFIPYGASISNLFITDKN
GIDRDIVLGFDNATYYSVDPVHPHFGGVPGRYANRIKNSTFTLDDDGEDYHIRPNENPTA
AHPAGVNTLHGGPDGWDHRNFTVVSYTKSSITFSLVDPDGKEGFPGEVISYITYTLSNRT
WDAKMVAIPTTKKTPIMLSSHTYWNLDGFANTEAPTALNHTFYLPFSGQTVAVDSILIPT
GEISPAPKGSVNDFWSAPRQIGEGFSLEGIEGNCGGGCTGYDNCWLVNRNYPYDWRSEDK
MVASLTSEWSGIKLEIWSDQEAFQMYSCNGMNGSMPIKATQGRDDGTGSRGVEKYGCVVL
EVQDWIDGINHPEWGRGPKQIFEPGGDPYVLQVRHRFSVDA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctctctcctccccctgggagctttcctccttgccacccctaccttatccgtc
ccctctttcacaggggaaccagactcctcaggtaaatactggctcttcgccccaggcata
acagcctccttcatcccctacggcgcctccatctccaacctcttcatcaccgacaagaac
ggcatagaccgtgacatcgtcctcggcttcgacaacgcaacctattactctgtcgatcca
gttcaccctcactttggcggcgtgcccggccggtacgccaaccgcatcaagaactcgacc
ttcacccttgacgacgatggagaagactaccacatccgtcccaatgaaaaccccaccgca
gcccacccagcaggtgtgaacaccctccacggcggccccgacggctgggatcacagaaac
ttcaccgtcgtctcctacaccaagtcatccatcacgttcagccttgtcgaccccgacggg
aaagaggggtttccaggggaagtaatcagttacatcacctacactttatcaaaccgaacc
tgggacgcaaaaatggttgctattcctacaacaaagaaaactccaatcatgctgtctagt
cacacctactggaacctagacgggttcgcaaacacggaagctcctaccgcgttgaaccat
acattttacctccccttttcagggcagacggtggctgtggatagcatcctcattcccacg
ggggaaatctcccctgcccccaaggggtccgtcaacgacttctggtctgcacccagacaa
ataggcgaggggttttcccttgaggggatcgaaggaaactgcggggggggttgcacgggt
tacgacaactgctggctcgtcaataggaactacccctacgattggaggtcggaggacaaa
atggtggctagtctgacgagtgagtggtcgggaataaaactggagatttggtcggatcag
gaggcgtttcagatgtatagctgtaatgggatgaacgggagcatgccgatcaaggcgacg
caggggagggatgacgggaccgggtcgagaggggtggaaaagtacgggtgtgttgttctg
gaggtgcaggattggatcgatgggattaatcaccctgagtgggggaggggaccaaagcag
atctttgagccggggggggatccgtatgttttgcaggtgaggcatcgctttagcgttgat
gcttga

DBGET integrated database retrieval system