KEGG   Podospora anserina: PODANSg6632Help
Entry
PODANSg6632       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     PODANSg6632
Protein kinases [BR:pan01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   PODANSg6632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 483 aa AA seqDB search
MSWKKSEKLMDTIRHYASFPATGVSLRQMVQFGEKPSSGTLFRASQFLAEELPIRLAHRV
QELETLPDGLNEMPSVKKVADWYAQFVRGMVFTEGCCRFEITTLPRPNLARDVRERLMKP
AQITGGKGNQWLSEATPNPSIEEGQYNSWTPVSQQNAVNNGWSKGKFPATRRYFAMVDDT
GDWPPELQLYNKRFAQTLHRIKRRHDSVVTTMAQGILEWKRKRQRMQIDNNIQSFLDRFY
MSRIGIRMLIGQHIALTDQSHYRDPSYVGIICTKTYVKDLAQEAIENARFVCEDHYGLFE
APKIQLVCNPNLNFMYVPGHLSHMLFETLKNSLRAVVETHGQDKQEFPVTKVIVAEGKED
ITIKVSDEGGGIPRSSIPLVWTYMYTTVDRTPNLDPDFDKSDFKAPMAGFGYGLPISRLY
ARYFGGDLKLISMEGYVHFLPPFQLSQHTNFGQQLRHRRLPPPQPPVQLVGATPIATSRH
EGC
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaaaaagagcgagaagttgatggacaccatcaggcattatgcaagcttccct
gccaccggggtaagcttgcgccagatggtccagtttggcgagaagccatccagtggtacc
ctattccgcgcctcacagttcctcgccgaagagctccccatacggctcgcccaccgcgtc
caggagctcgagacgttgcccgatggccttaatgagatgccatcggtgaagaaggtggca
gattggtatgcgcagttcgttcgaggtatggtttttacagaaggctgttgtcgctttgaa
atcacaacactaccaagaccgaacctcgccagagatgtacgagagagattaatgaagccc
gcgcaaataaccggagggaaaggaaaccaatggctgagcgaggcgacaccgaacccaagc
atcgaggagggccagtacaactcgtggacgccagtgtcgcagcaaaacgccgtcaacaat
ggctggtcaaaggggaagttccccgcaacaagaagatacttcgctatggtcgacgacacg
ggagactggccgcccgagctgcagctttacaacaagaggttcgcccagacactgcaccgc
atcaagaggagacacgatagcgtcgtgaccaccatggcgcagggcatcctcgagtggaag
cgcaagcggcaacggatgcagatcgacaacaatatccagtcattcctcgatcgcttctac
atgtcacgcatcggcatccgcatgctgatcgggcagcacatcgccctgaccgatcagagc
cactaccgggacccgtcctatgtcggtattatctgcaccaagacgtacgtcaaggacttg
gctcaggaagccatcgagaacgcgcgttttgtctgcgaggaccactacggcctgttcgag
gcgcccaagatccagctcgtgtgcaatcctaacttgaactttatgtacgtgcctgggcac
ctgtcgcacatgctctttgaaacgctcaagaactcgctgcgtgcggttgtcgagacgcac
ggccaggacaagcaggagtttcccgtcacgaaggtgattgtggccgagggcaaggaggat
atcacgatcaaggtttcggacgagggcggcggtataccgcgcagctcgatcccgcttgtt
tggacgtacatgtacaccactgtcgacaggacaccaaacctggaccctgatttcgacaag
agcgactttaaggctcccatggcgggttttgggtatgggttgccgataagtcgtctgtac
gcgaggtatttcggtggggaccttaagctgatcagcatggaagggtatgttcattttctt
cccccttttcaactgtcacagcatactaatttcggccaacagctacggcacagacgtcta
cctccacctcaaccgcctgtccagctcgtcggagccactccaatagcaaccagtcgtcat
gaggggtgctag

DBGET integrated database retrieval system