KEGG   Podospora anserina: PODANSg6683Help
Entry
PODANSg6683       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pan  Podospora anserina
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PODANSg6683
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PODANSg6683
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PODANSg6683
Lipid biosynthesis proteins [BR:pan01004]
 Desaturase
  First
   PODANSg6683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 437 aa AA seqDB search
MSVTVTEEPATMLAWEKNPLALPLPKVEKPAETLWQRIKWESMIVLTVSPIIGLYGLLFV
PLQTKTLWWSVFLYWFSIIGSTAGSHRLYSHRSFKASTPLQIFLLIGGTCGVQGSAFWWA
REHRAHHRYTDSDLDPHSGKEGFWWTHAGWILFRRDIQAGPTDVSDLKKNKLVMFQHRHY
FKLFPFLAYVMPAAVAGYFWGDWAGGICYAAMLRLTIVQHSIMCINSLAHTFGDAPFDDK
HTPRNHFFTAIVTAGEGYHNFHHQFPVDYRNGIKWYQYDPTKWFIYLSSRLGLSTQLQTF
PQNEISKGELTMTLRRLKEKQEDIKWPARPDKLPLVSWETFQREAKKNSLILINGYIHDA
SEFENKHPGGKAIIRARVGKDATAAFGGGVYEHSNAAHNLLAMMRVAVLEGGVEHVKYVT
PAERLRIIEHYKEEESH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaccgtcaccgaagaaccggcgacgatgctggcctgggagaagaacccactg
gcgcttccattgcccaaggttgagaagcctgctgagacgctatggcaacggatcaagtgg
gaaagcatgattgttctcactgtctccccgataataggtctatacgggcttctctttgtg
cccttgcagaccaagacattgtggtggtcagtcttcctgtactggttcagcatcatcggc
tcaaccgccggctcccacagactctactcccaccgctccttcaaagcctccacccccctc
cagattttcctcctcatcggcggcacctgcggcgtccaaggctcggccttctggtgggct
cgcgagcatcgcgcccaccaccgctacaccgactcggacctcgacccccactccggaaaa
gaaggcttctggtggacgcacgccggctggatcctcttcaggcgagacatccaagccggc
cccacagacgtctccgacctcaagaagaacaagctcgtcatgttccaacaccgtcactac
ttcaagctcttccccttcctggcctacgtcatgccagcggcagtagcaggatacttctgg
ggtgactgggcaggcggcatctgctacgcggccatgctcaggctgacgatcgtccagcac
agcatcatgtgcatcaactcccttgcccacacctttggcgacgccccatttgacgacaag
cacactccccgcaaccacttttttacggccatcgtcactgccggggaggggtaccacaac
ttccaccaccagttccctgttgactaccgcaatgggatcaagtggtatcagtacgacccg
acaaaatggttcatctacctcagctcccggcttgggttgtcgacgcagctgcagactttt
ccccaaaacgaaatcagcaagggggagctgaccatgacgctgagaagactgaaggagaag
caggaggatatcaaatggccggctaggccggacaagctcccgcttgtgagctgggagacg
tttcagagggaggcgaagaagaattcgctgattttgatcaatgggtacatccatgacgcg
agcgaatttgagaataaacaccctggcggaaaggcgattattagggcgagggtggggaag
gatgcgacagctgcgtttggagggggggtttatgagcatagcaatgctgcgcataatttg
ctcgcgatgatgagagttgctgtgctcgaggggggtgttgagcatgtcaagtatgtgacg
ccggcggagaggttgagaattattgagcattataaggaggaggaaagccattaa

DBGET integrated database retrieval system