KEGG   Podospora anserina: PODANSg6701Help
Entry
PODANSg6701       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
pan  Podospora anserina
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PODANSg6701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 108 aa AA seqDB search
MPVGAGDSKKGANLFKTRCAQCHTLEAGGGNKIGPALHGLFGRKSGTVEGYAYTDANKQK
GVVWDDQTLFDYLENPKKYIPGTKMAFGGLKKDKDRNDLITFLKESTA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcggagccggtgattccaagaagggtgccaacctcttcaagacccgttgcgct
cagtgccacacccttgaggctggcggcggcaacaagatcggtcctgcgctccacggcctt
ttcggacgcaagtctggtaccgttgagggctacgcctacaccgatgccaacaagcagaag
ggtgttgtctgggatgaccagaccctcttcgactacctcgagaaccccaagaagtacatc
cccggcaccaagatggctttcggtggtctcaagaaggacaaggacagaaatgacctcatc
actttcctcaaggagtctaccgcttaa

DBGET integrated database retrieval system