KEGG   Podospora anserina: PODANSg6701Help
Entry
PODANSg6701       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
pan  Podospora anserina
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 6193440
NCBI-ProteinID: XP_001909665
UniProt: B2B0B7
Position
3
AA seq 108 aa AA seqDB search
MPVGAGDSKKGANLFKTRCAQCHTLEAGGGNKIGPALHGLFGRKSGTVEGYAYTDANKQK
GVVWDDQTLFDYLENPKKYIPGTKMAFGGLKKDKDRNDLITFLKESTA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcggagccggtgattccaagaagggtgccaacctcttcaagacccgttgcgct
cagtgccacacccttgaggctggcggcggcaacaagatcggtcctgcgctccacggcctt
ttcggacgcaagtctggtaccgttgagggctacgcctacaccgatgccaacaagcagaag
ggtgttgtctgggatgaccagaccctcttcgactacctcgagaaccccaagaagtacatc
cccggcaccaagatggctttcggtggtctcaagaaggacaaggacagaaatgacctcatc
actttcctcaaggagtctaccgcttaa

DBGET integrated database retrieval system