KEGG   Podospora anserina: PODANSg6734Help
Entry
PODANSg6734       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K12195  
charged multivesicular body protein 6
Organism
pan  Podospora anserina
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pan00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PODANSg6734
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PODANSg6734
  Exosomal proteins of other body fluids (saliva and urine)
   PODANSg6734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 214 aa AA seqDB search
MGGNSSKITAQDQAIYDLKLQRDRLHQYQRRITLLTSRETEIARALLAQNNRPRALLALR
RKKYQESLLAKTDQQLEQLEKLVSSVEFALIQKDVVFGLQQGTKVLKEIHAEMGGIDKVE
KLMGETAEEVEYQREVSEMLGGRISVQDEEEVEEELAALERELGEPKKKEEETPSRVVVE
GGLPDVPGTELPAGEQRQEGVKKPVAERREAVAA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaactcgagcaagataacagcccaagaccaagcaatctacgacctcaaactc
caacgcgaccgcctccaccaataccaacgccgcataacccttctcacctcccgggaaacc
gaaatcgcccgcgccctcctcgcccaaaacaaccgtccccgcgccctcctcgccctccgc
cgaaagaaataccaagaatccctcctcgccaaaaccgaccagcaactcgagcaactagaa
aaattggtatcttctgtagaattcgcactcatccaaaaagacgtcgtctttgggctgcag
caggggacaaaagtcctcaaagaaatccacgccgagatgggcgggatcgacaaggtggaa
aaactgatgggggagacggcggaggaggtcgagtaccagagggaggtgagcgagatgttg
gggggcaggatcagtgtccaggatgaggaggaggtggaggaggagttggctgcgttggag
agggagttgggagaaccaaagaagaaggaggaggagactcctagtagggtggtggtggag
ggggggttgcctgatgtgccggggacggagttgcctgctggagagcagaggcaggagggg
gtcaagaaaccggttgctgagaggagggaggcggttgctgcttga

DBGET integrated database retrieval system