KEGG   Podospora anserina: PODANSg7061Help
Entry
PODANSg7061       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K13830  
pentafunctional AROM polypeptide [EC:4.2.3.4 4.2.1.10 1.1.1.25 2.7.1.71 2.5.1.19]
Organism
pan  Podospora anserina
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pan01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pan00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1567 aa AA seqDB search
MTSSTGSGPTRISILGKDDIIVDHGIWLDFVTHDLLQNIPSSTYVLITDTNLHDTYVPAF
QEVFERAAGQDARLLTYTIPPGEYSKGRETKAEIEDWMLSHQCTRDTVIIALGGGVIGDM
IGYVAATFMRGVRFVQVPTTLLAMVDSSIGGKTAIDTPMGKNLVGAFWQPRRIYIDLAFL
ETLPVREFINGMAEVIKTAAIWNETEFTALEDNAPAILEAIRSKPTGTGARLAPIRDILK
RIVLGSAGVKAEVVSADEREGGLRNLLNFGHSIGHAYEAILTPQVLHGECVAIGMVREAE
LARFLGVLPPGAVARLTKCIASYELPTSLHDKRIVKLTAGKECPVDVLLQKMGVDKKNDG
RKKKVVLLSAIGKTYEPKATVVEDRAIRIVLSPSVRVTPGVPKGLNVSVTPPGSKSISNR
ALVLAAMGEGTTRIKGLLHSDDTHYMLTAIAQLQGATYTWEEAGEVLVVKGRGGKLLASN
EPLYLGNAGTASRFLTSVVALCSPTDTTTSTVLTGNARMKVRPIGPLVDALRSNGVAVKY
LEKENSLPVQVDAVSGFAGGVIELAATISSQYVSSILMAAPYARQPVVLKLVGGKPISQF
YIDMTIAMMASFGVKVERDAEDPNTYHIPQGSYKNPEEYVVESDASSATYPLAVAAITGT
TCTIPNIGRTSLQGDARFAVDVLRPMGCTVEQTDTSTTVTGPPVGALKAIPHVDMEPMTD
AFLTASVLAAVASGTTQITGIANQRVKECNRIKAMKDELAKFGVHCSELEDGIEVTGKPY
KELANPEPIYCYDDHRVAMSFSVLSVLAPHKVLILERECTAKTWPGWWDILSQKFNVHLE
GEEDPTKKCTAKSSRPSTDRSIFIVGMRGAGKSTAGRWMSDILKRPLIDLDVELEKREKA
TIPEIIRSERGWEGFRKAELELLEDMIKNNSKGHVFSCGGGLVETEAARKLLISYQKNGG
SVLLVHRDTDQVVEYLMRDKTRPAYSENIREVYYRRKPWFEEVSNFQYHSPHHNGSEEAP
EDFSRFLSVISGSSTHFEDVLAKKHSFFVSLTVPNVAKALDIIPKVVVGSDAVELRVDLL
ESLNPEFVATQVALLRSAAKIPIVYTIRTISQGGKFPDDDYKRALELYQIGLRTGVEYLD
LEMTMPEDVLQTVTETKGFTHIIASHHDPENKLSWKNGGWIPFYNKALQYGDVIKLVGMA
REVSDNFDLTNFKMRMLEAHKKPIIALNMGTAGKLSRVLNGFLTPVSHPALPSKAAPGQL
SAAEIRQALSLVGELEPKSFYLFGKPISSSRSPALHNGLFAQTGLPHQYSLFETDVAADV
KDIIRSADFGGASVTIPLKLDIIPLLDEVSDAATAIGAVNTVIPVSPEGSDKTILRGDNT
DWMGMVFSLRQAGIAPRTKTNPGAGMVVGSGGTTRAAVYALHDLGYSPIHIVARSPDRVK
AIADSFPEDYNIQTLSTPEEVKAATDALPTVVISSIPADKPIDQSMREVLVASLRHPAKS
EKEPRVLLEMAYTPRHTPLMQLAEDAGWKTIPGLEVLAAQGWYQFQLWTGVTPLYADARA
AVMGDSE
NT seq 4704 nt NT seq  +upstreamnt  +downstreamnt
atgacaagttctaccgggtcgggtcccacgcggatctcgattttgggcaaagacgacatc
atcgtcgaccatggcatctggctcgactttgtgactcacgacctcctccaaaacatcccc
tcgtccacctacgtcctcatcaccgacacaaacctccacgacacctacgtccctgccttc
caagaggtattcgagagggctgctggtcaagatgcccgcctcctcacctacaccatccct
cccggcgagtactccaagggccgcgagaccaaggccgagatcgaggactggatgctctcc
caccaatgcacccgtgacaccgtcatcatcgcacttggtggcggcgttattggagatatg
atcggatacgtggcagccaccttcatgcgtggtgtacgcttcgtgcaggtccctacgaca
ctgctcgccatggtcgactcgtccatcggcggcaagacggccattgacacccccatgggg
aagaacttggttggtgccttctggcaaccacgccgcatctacattgatcttgccttcctc
gagactctccccgtgcgtgagttcatcaatggcatggccgaggtcatcaagactgctgcc
atctggaacgagaccgagttcaccgccctcgaagacaatgcccctgccattctcgaagct
attcgttccaagcccacggggactggtgctcgcttggctcctattcgtgacatcttgaag
cgcattgttctgggctcagccggtgtcaaggccgaggttgtgtcggctgatgaaagagag
ggtgggttgcgcaacctgctcaactttggccactccattggtcatgcctatgaagctatc
ctgactccccaggtgttgcatggcgagtgcgtcgccatcggaatggtcagggaggccgag
ctcgcccgtttccttggtgtccttcctcccggtgctgtcgctcgtttgacaaagtgcatc
gccagctacgagttgcccacctctcttcacgacaagcgcatcgtcaagctgacagctgga
aaggagtgccctgtcgatgttctcttgcaaaagatgggtgtcgacaagaagaacgacggc
cgcaaaaagaaggtcgtgctcctgtcggccatcggcaagacgtacgagcccaaggctacc
gtggtggaagatcgggctattcgcatcgtcctctctccatccgtccgggtgactcccggc
gtgccaaagggtctcaatgttagtgtcactcccccaggatccaagagtatctccaaccgc
gctcttgtgctcgcggctatgggcgagggaacaactcgtatcaagggtctgctccactcc
gatgacacgcactacatgttgactgccattgctcagctccaaggtgccacttacacgtgg
gaagaggcaggtgaggtccttgtcgtcaagggcagaggaggaaagctgctggccagcaac
gagcctttgtatctcggcaatgcgggcaccgcctctcgcttcctcacatctgttgtggcc
ctctgctcgcccaccgacaccaccacatccactgtcctcactggcaatgctagaatgaag
gtcagaccaatcggcccgcttgtcgatgcccttcggtccaacggtgtggctgtcaagtac
ctggagaaggaaaacagcttgccagttcaggtggacgctgttagcggtttcgctggtggt
gtgattgagctggctgccaccatctcgtcgcagtatgtctcttcaatcctgatggcggct
ccctacgcccgtcagccagtggtgctcaagctggttggaggcaagcccatctctcagttc
tacatcgacatgaccattgccatgatggcttcctttggtgtcaaggtcgagcgcgatgct
gaggaccccaacacctaccatatcccccagggttcttacaagaaccccgaagagtacgtc
gtggaaagcgacgctagctcggccacgtaccccttggctgtggctgccattactggcacg
acctgcaccatccccaacattggccgcacatcgctccagggagatgctcgctttgccgtc
gacgtcctccgccccatgggctgcacggtcgagcagaccgacacctccaccactgtcacc
ggtccccctgtgggagccctcaaggccattcctcacgtagacatggaacctatgacagat
gccttcctaacagcctctgtccttgctgctgttgcttcaggaaccacacagattactggc
attgccaaccaaagagtgaaggagtgcaaccgcatcaaggccatgaaggacgagctggca
aagttcggcgtgcactgctccgagctcgaggatggtattgaggtcaccggcaagccttac
aaggagctggcgaaccccgagcccatctactgctatgacgaccatcgcgttgccatgagc
ttcagtgttctctccgtcctggctccccacaaggttctcatcttggagcgtgagtgcact
gccaagacctggccaggttggtgggacattctgtctcaaaagttcaacgtccatctcgag
ggcgaagaagaccctacgaaaaagtgcactgccaagtcttctcgtcccagcaccgaccgg
tccatctttatcgttgggatgcgtggtgctggcaagtctactgccggccgctggatgtcg
gatatcttgaagaggccattgatcgatcttgacgtggagctcgaaaagagagaaaaggct
acgatcccagaaatcattcgcagcgagcgaggatgggaagggttcagaaaggctgagctg
gagctccttgaagatatgatcaagaacaactccaagggccacgtcttctcttgtggcggt
ggtctcgttgagacagaggcggcacgcaagctgctcatttcctaccaaaagaatggcggc
tctgttctcctggttcaccgggacactgaccaggttgtggagtacttgatgagagataag
actcgccctgcctactcggaaaacatccgtgaagtctactaccgtcgcaagccatggttc
gaggaggtcagcaatttccagtaccacagcccgcatcacaatggctctgaagaggcgccc
gaagactttagccgcttcttgtcagtcatcagcggcagctctactcactttgaggatgtc
ttggccaagaagcacagcttttttgtctctctgaccgtccctaatgtggcaaaggcactc
gacatcatccccaaggtggttgtcgggtccgatgctgtggagctgcgtgtggacttgctg
gagagcttgaatccagagtttgtggcaactcaagtcgcgcttcttcggtctgctgcaaag
attcctatcgtctacacaatccgtacaatcagccaagggggtaagttccccgatgatgac
tacaagcgtgcgcttgagctctaccagatcggtcttcggacaggagttgagtatctcgac
ttggagatgaccatgccagaggatgtcctccagactgtgaccgagacaaagggcttcacc
cacatcatcgcgtctcaccacgaccccgagaacaagctgtcttggaagaatggcgggtgg
attcctttctacaacaaggctctgcagtacggagatgtcatcaagcttgtgggtatggcc
cgcgaggtttctgacaacttcgacctgacaaacttcaagatgaggatgctggaggcgcac
aagaagcccatcatcgctttgaacatgggcaccgcgggcaagcttagtagggtgctcaac
ggattcttgaccccggtctctcacccagctctgccatctaaagcggcacctggacagctc
tcggcagcggagatcaggcaagcattgtctctcgttggcgagcttgagccaaagtctttc
tatctgtttggaaagcccatctcatcctcgcgctctcctgcgctgcacaatggactgttt
gcccagaccggccttcctcatcagtactcactgttcgagacagacgtcgctgctgatgtc
aaggacatcatccggtctgccgactttggcggtgcctctgtcaccatcccgctcaagctc
gacatcattcctttactggacgaggtatcagacgccgcaaccgccataggagccgtgaac
accgtcatccccgtctccccagagggcagtgacaagaccattctccgcggagataacacc
gactggatgggcatggtcttttctctccggcaagccggtatcgcccctcgcaccaagacc
aacccgggcgccggcatggtggtcggatcaggcggcactactcgcgccgccgtctacgcc
ctccacgaccttggatactcgcccatccacattgtcgcccgcagcccggatcgcgtcaag
gcgattgccgactccttccctgaggactacaacatccagaccttgtccacgcctgaggag
gtcaaagcggcgacggatgccctcccgacggtggttattagtagcatccccgccgacaag
cccattgaccagagcatgcgcgaggtgctggttgcttcgctgaggcaccctgccaagtcg
gagaaggagccgcgggtgctgctggaaatggcttacacgcctcgccacacgccactgatg
cagctggcggaggatgcggggtggaagacgattcccgggctggaggtgctggctgctcag
ggttggtatcagttccaactctggacaggagtcacccccttgtacgccgatgctagggct
gctgtgatgggggactcggagtga

DBGET integrated database retrieval system