KEGG   Podospora anserina: PODANSg7093Help
Entry
PODANSg7093       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pan  Podospora anserina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PODANSg7093
Enzymes [BR:pan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PODANSg7093
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PODANSg7093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 707 aa AA seqDB search
MDPVALESSNTLAKNGHTAGNIPNDGTGVVALDPYLEPFKPALKRRFDKAQEWIKKIEKT
EGGLDKFSKGADTFGIHQNDDGSIYYKEWAPNAKQAAVIGEFNNWDRNAHRMTRNDFGVF
EITIPPTSDGKAAIPHNSKIKISLELPDGQWIDRLPAWIKYVTQDLSVSPAYDARFWNPP
ASERYSFKHQRPKRPESLRIYEAHVGISSPELRVTTYKEFTKNMLPRIKSLGYNAIQLMA
IMEHAYYASFGYQVNNFFAASSRYGPPEDLKELVDTAHSLGLVVLLDVVHSHASKNVLDG
LNEFDGTDHQYFHAGAKGKHELWDSRLFNYGHHEVLRFLLSNLRFWMDEYHFDGFRFDGV
TSMLYLHHGIGTGFSGGYHEYFGADVDEEAVVYLMLANELLHELYPDVITVAEDVSGMPA
LCLPLSLGGVGFDYRLAMAIPDMWIKILKEKKDEEWDIGNITFTLTNRRHGEKTIAYAES
HDQALVGDKSLMMHLCDAELYTHMSTLTPLTPVIDRGMALHKMIRLLTHALGGEGYLNFE
GNEFGHPEWLDFPREGNQNSFWYARRQLNLTEDRLLRYQFLNNFDRSMNLCENKYGWLHA
PQAYISLKHEGDKVIIFERAGVVFAFNFHPTQSFENYRIGVDVAGTYRVVLDSDTKEHGG
FSRVDSNTRFFTEPLEWNHRRNCTHIYLPCRTALVFALESTTTPNGH
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgttgctcttgaatcgtccaacaccctggccaagaatggtcataccgctggt
aacatccccaatgatggaactggcgtggttgccctcgatccctatcttgagccattcaag
cctgcgttgaagagacgctttgacaaggctcaagaatggatcaagaagattgagaagacc
gaaggtggtctggacaagttcagcaagggcgccgacacatttggcatccatcaaaatgac
gacggcagcatctactacaaggaatgggcacccaatgccaaacaggcagctgtcattggt
gaattcaacaactgggaccgcaatgcccatcgcatgacgaggaacgactttggtgtcttt
gagatcaccattcctcccacctctgacggcaaagctgccatcccccacaactccaagatc
aagatctctcttgagctcccagacgggcagtggatcgacagactaccggcctggatcaag
tatgtcacccaggatctctccgtctcgcccgcctacgacgctcggttctggaaccccccc
gcctctgagaggtactctttcaagcaccagaggcccaagaggccagagagcttgaggatc
tacgaagcccatgtcggtatctcgtcaccagagctcagggttaccacctataaggaattc
accaagaacatgctcccacgcatcaagagcctgggttacaacgccatccagctcatggcc
atcatggaacacgcctactatgccagcttcggctaccaggtcaacaacttcttcgccgcc
agcagcagatatggcccgcctgaggacctgaaggagttggtcgacacggctcacagcctg
ggactcgttgttcttctcgatgttgttcacagtcacgcttccaagaacgtcctggacggc
ctgaacgagtttgatggcacagaccaccagtacttccacgcgggtgccaaaggaaagcac
gagctctgggacagcagactgttcaactatggccaccatgaggtgctcagattcctcttg
agcaacttgagattctggatggacgagtaccactttgatggattccggttcgacggtgtt
actagcatgctttaccttcatcacggtattggaaccggcttctcgggaggttaccacgag
tactttggtgctgatgtcgacgaggaggctgttgtctacctcatgttggccaacgaactg
cttcacgaactctaccctgacgtcatcacggttgctgaggatgtctctggcatgccggcg
ctttgtctgccactctcactgggtggtgttggcttcgactacagacttgccatggccatt
cccgacatgtggatcaagatcctcaaggagaagaaggatgaggagtgggacattggcaac
attaccttcaccctcaccaaccgccgccacggcgaaaagacgatcgcctatgccgagagt
cacgatcaagctcttgtcggtgacaagtctctcatgatgcatctgtgcgacgctgagctc
tacacccatatgtctacgctcaccccattgaccccggttattgaccgcggtatggccttg
cacaagatgatccgtctgttgacccatgctctcggaggcgagggctacctcaactttgag
ggcaacgagtttggtcaccccgagtggttggacttcccccgcgagggcaatcagaactct
ttctggtatgctcgccgccagctgaacctgaccgaggaccgcctccttcggtatcagttc
ctcaacaactttgaccgctccatgaacttgtgcgagaacaagtatggctggctgcatgct
ccccaggcgtacatctcgctcaagcacgagggtgacaaggtcatcatctttgagcgggct
ggcgtggtgtttgctttcaacttccacccaacacagagctttgagaactaccgcatcggt
gtcgatgtcgcaggcacatatagggttgtgctcgactctgacaccaaggagcacggcggc
tttagcagagtcgactcgaacacacggttcttcaccgagcctctggagtggaaccaccgg
aggaactgcactcatatctacctcccttgcaggactgctctggtctttgctttggagtcg
accaccactcccaacggtcactga

DBGET integrated database retrieval system