KEGG   Podospora anserina: PODANSg7127Help
Entry
PODANSg7127       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 244 aa AA seqDB search
MSNPDPPTTTAPAFIPLEANPELMTTLLTNLGMSPTLALHDVYSLTDPDLLSFIPRPAYA
LLLVFPITPTYESHRLAEDSLLPDHVPTPDYPVIWFRQTIRNACGLMGLLHAIANSPAEF
ITPDSDLDRIVKTALPLDTIGRARLLETEESLARAHRTAAERGDTAAPEATDEVDLHYVA
FVKGRDGGLWEMDGRRKGPIRRGELEGVEDVLSEKGLVLGARKFLEREGGDLRFSAVALA
RGYD
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccccgacccccccaccaccacagcgcccgccttcatccccctcgaagccaac
ccagagctcatgacaaccctcctcaccaacctgggcatgtcccccaccctcgccctccac
gacgtctactccctcaccgaccccgatttgttgtctttcatcccccgcccagcctacgcc
ctcctcctcgtcttccccatcaccccaacctacgaatcccaccgtctggcggaggactcc
ctcctccccgaccacgtccccaccccggactaccccgtgatctggttcagacagacgatc
cgcaacgcctgcgggctcatgggcctcctccacgccattgctaattctcccgccgagttt
atcacccccgacagcgaccttgacaggattgtcaagacggcgttgccgctggacacgatc
ggacgggcgaggttgctggagacagaggagagtttggcgagggcgcataggacggcggcg
gagaggggggacacggctgctcccgaggcgacggatgaggttgatttgcattatgttgct
tttgtcaaggggagggatggggggctttgggagatggatgggagacggaaggggccgatc
aggaggggggagttggagggggtggaggatgtgttgagcgagaaggggttggtgttgggg
gcgaggaagtttttggagagggaagggggggatttgaggtttagtgctgttgcgctggcg
agggggtatgattag

DBGET integrated database retrieval system