KEGG   Podospora anserina: PODANSg7163Help
Entry
PODANSg7163       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00618  
amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
pan  Podospora anserina
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    PODANSg7163
   01230 Biosynthesis of amino acids
    PODANSg7163
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PODANSg7163
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     PODANSg7163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 674 aa AA seqDB search
MPLVAAMLTRSNGAWKKATSVVQASICRDQQRPNHTTITSVTSVSQRRHFSSAENGAKPS
RSHPSAAEAKQKRESDREFLISVLESSATKRDAKAYLQTYGSSKAKAVPKESPASTALVS
DKAIPEAKDVSFFVQGSVPVESLEADEVPRVAIVKLREPQTWDDTLLGGVAKTLTRLRDL
GLRSVIVLECSAEKSSVLDWKDVVTQQTDRLQKAIQKYGTPGAELVDGGIWKRSTTPPSA
SSLGHTKLSVGFGEAFTAPLRHGHILVVPSRAVVEETLEHTAADANEVIFALAKYFAGLQ
VNAGQNQTRTAVVDRVIIIDPFGGIPARNLGDGARVFINLEEQFNSIKATLSAAEPQDNG
SPIPGISGNPKASHIENLELVKNILAILPSTASAVITSPIEAANLQSNQAYDIRRDAEEA
MAGEVKTRRWQNPIIHNLLTDRPIYSASLPIGRIKSTTNGTYQRSSRMPTTTLAKKGLPV
TIFPDTRTRSWQPPKPGTPRLKLTDTCVDLPRLIHLINDSFGRKLDAEHYLNRVQDSLAG
IIIAGEYEGGAILTWERPFGLDEETAYNSGRLVPYLDKFAVLKKSQGAGGVADIVFNAMV
RDCFPNGVCWRSRKDNPVNKWYFERSRGVRKLPGSNWAMFWTTPEAAVKDQVMEDYEDVC
RGVVPSWADSKAAD
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgccactggtcgcagctatgctcacgagaagcaacggtgcgtggaagaaggcgacctcg
gtagttcaggcctcaatctgtcgtgaccagcaacggccaaatcacaccaccataacgtca
gtgacatcagtgtctcagcgacgtcacttctcctcggctgagaatggcgcaaagcccagc
cgaagccacccttctgctgccgaagcaaagcagaagagagagtcagacagggagtttttg
atttcagtactggagtcgtcggcgaccaagcgggatgcaaaggcataccttcagacctat
gggtcatcgaaagccaaagcggtgccaaaggaatcaccagcttctaccgcccttgtgagc
gacaaagcaatcccagaagccaaggatgtgtcatttttcgtccaaggctccgttccagtg
gaatctctagaggccgatgaagtaccacgtgtggcgattgtgaagcttcgcgagcctcag
acgtgggacgacactttactgggtggcgtcgctaagacgctcacccggctgcgagatctg
ggtcttcgaagtgttattgttctcgaatgcagcgcagagaaaagctcagttctggattgg
aaagatgtggtgacacaacaaacagaccgacttcagaaagccattcaaaagtatggcaca
ccaggcgcggaacttgttgatggaggcatctggaaacggagtacaactccaccaagcgct
tcgtctcttggtcatactaagctctccgttggctttggggaggcattcaccgcgccgctc
aggcatggccatatcctagtggtcccctctcgggcagtggtcgaagagactctagagcac
acggcggctgacgcaaatgaagtgatctttgctttggcaaaatactttgctggacttcag
gtcaatgctggccaaaatcaaacccggaccgcggtggtagacagggtgatcatcatcgac
ccctttggcggaattcctgctaggaacctgggcgatggcgcgcgggtatttatcaatctc
gaagagcagttcaacagcatcaaggcgaccctgagtgcagcggaaccacaagataacggg
agcccaatacctggtatctcaggcaacccgaaagcttcacacatcgaaaacctagagctc
gtcaagaacatactagcaatcctgccctcgacagcttccgcggtcataaccagcccaatc
gaagccgcaaatctacagtcgaatcaagcatatgatatcagaagagacgccgaggaggct
atggcaggtgaagtcaaaacacgaagatggcagaatcccatcattcacaaccttctcacc
gaccggccgatatactcggcgtctctacccatcggccggatcaaatcaacgacaaatggt
acataccaaaggtcatcccgaatgcccaccacaaccctggcgaagaaaggcctccctgtt
accatcttccccgacacccgcacacggtcctggcaaccacctaaaccgggcaccccccgc
ctgaaactaacagatacgtgcgtcgacctcccccgactcatccacctcatcaacgactcc
ttcggccgcaagctggacgcagagcactacctcaaccgagtccaagactccctcgcaggt
atcatcatcgccggcgagtacgaaggcggtgcgatcctcacttgggaacgaccattcggg
cttgacgaggagacagcgtacaactcgggtagattagtgccctacctggataagtttgcc
gtgttgaagaagagtcaaggggcgggaggtgtggcggatattgtgttcaatgccatggtg
agggattgtttcccgaatggggtgtgctggaggagcaggaaggataacccagtgaataag
tggtattttgagaggagcaggggggtgagaaagttgcccgggagtaactgggcgatgttt
tggacgacgccggaggccgcggtgaaggatcaggtcatggaggactatgaggatgtttgt
aggggggttgtgccgagttgggctgattcgaaggcggcggattga

DBGET integrated database retrieval system