KEGG   Podospora anserina: PODANSg7211Help
Entry
PODANSg7211       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PODANSg7211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 692 aa AA seqDB search
MAELDTLDIIVLAAILLGTVAYFTKGKLWGVAKDPYASSLAAASGAKAGKTRNILEKMEE
SGKNCIIFYGSQTGTAEDYASRLAKEGKSRYGLETMVADLEDYDYDNLDAIPEDKVVMFV
LATYGEGEPTDNAVDFYEFINGDSPQFTLDNEPALGNLNYVAFGLGNNTYEHYNIMVRNV
DKALQKLGAHRIGQAGEGDDGAGTMEEDFLAWKDPMWKALAEKMGLEEREAVYEPVFGIV
ERDTLTAESPEVYLGEPNKTHLDGTPKGPFNAHNPYIAPIAESYELFNVKDRNCLHMEVD
ISASNLSYQTGDHLAVWPTNPGEEVDRFLNVLGLTEKRKDVISVKALEPTAKVPFPTPTT
FDAIVRYHMEICAPVSRQFLATLAPFAPDEASKAEMTNLGGDKDYFHDKINVHHLNIGRV
LEIVGKGQKWSNVPFSAFIEGITKLQPRYYSISSSSLEQPKKISITCVVEEQKLPGREDP
FRGVSTNYLLALKQKQNGDPNPSPYGLTYEITGPRNKYDGIHVPVHVRHSNFKLPSDPLK
PVIMVGPGTGVAPFRGFVRERRKMVENGQTVGKTILFFGCRKSTEDFLYSKEWEEAKQVM
GDSFEIVTAFSRESNKKVYVQHRLKERSKEINELLEKKAYFYVCGDAANMAREVHNVLGQ
IISEERGVPEAKAEDIVKNMRASNQYQEDVWS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactcgatacgctggacattattgtcctagccgccatcctcttggggacggtg
gcatacttcaccaagggcaagctttggggcgtcgccaaggacccctatgccagctctctc
gcggccgccagtggcgccaaggctggaaagacaagaaacattctcgagaagatggaggag
tctggcaagaactgcattattttctatggatcgcaaactggcaccgctgaggactacgcc
tcgagactcgcaaaggagggcaagagccgttatggcctcgagaccatggttgccgacttg
gaggactacgactacgacaatctcgatgccatccctgaggacaaggtcgtcatgtttgtg
cttgccacctacggtgagggcgagcccaccgacaacgctgttgacttttacgagttcatc
aacggagactccccgcaattcactttggacaacgaacccgctcttggcaacctgaactac
gtcgctttcggtcttggcaacaacacttatgagcactacaacatcatggttcgcaacgtg
gacaaggcccttcagaagctgggtgcccaccgcattggtcaggctggcgagggtgacgat
ggcgctggcaccatggaagaggatttcttggcttggaaggaccccatgtggaaggctctc
gctgagaagatgggtcttgaggagcgcgaggctgtctatgagcccgtatttggtatcgtt
gaacgtgacactcttactgccgagtcccctgaggtctaccttggtgagcccaacaagacc
cacctcgatggtacccccaagggccccttcaacgcgcacaacccctacatcgcccctatc
gccgaatcctacgagttgttcaacgtcaaggaccgcaactgccttcacatggaagtcgac
atcagcgcctctaatctcagctaccagactggtgaccatctcgctgtttggcccaccaac
cctggcgaggaggtcgaccggttcctcaatgtcttgggtctcactgaaaagcgcaaggat
gttatctctgtcaaggccctggaacccaccgccaaggtccccttcccgacccccaccacc
ttcgatgccattgttcgctaccacatggaaatctgcgctcctgtctctcgtcaatttctc
gctactcttgcccccttcgctcccgacgaggcttccaaggctgagatgaccaacctcggt
ggtgacaaagactacttccacgacaagatcaacgttcatcatctcaacatcggccgcgtt
ctggaaattgttggcaagggtcagaagtggtccaacgtccccttctccgctttcattgag
ggcatcaccaagctgcaaccccgttactactccatctcgtcctcttcccttgagcaaccc
aagaagatttccatcacctgcgtcgtcgaggagcagaagctccccggtcgcgaagatcct
ttccggggtgtctctaccaactacctcttggctctcaagcagaagcagaacggcgacccc
aaccccagcccctatggtttgacttacgagatcactggtccccgcaacaagtacgatggt
atccacgtccccgtccacgtccgccattccaacttcaagctgccctcggatcccctcaag
cctgtcattatggttggccctggtaccggtgttgctcctttcagaggtttcgtccgtgag
cgcagaaagatggttgagaacggtcagaccgttggtaagaccatcttgttctttggctgc
cgcaagtccaccgaggacttcttgtactccaaggagtgggaggaggccaagcaggtcatg
ggagacagcttcgagattgttactgccttctctcgcgagagcaacaagaaggtctatgtc
cagcaccggctgaaagaaaggtccaaggagatcaacgagctccttgagaagaaggcttac
ttctatgtttgcggtgacgccgccaacatggcccgtgaggtacacaatgtgctgggccag
atcatttctgaggagaggggtgtcccagaggccaaggctgaggacatcgtgaagaacatg
agggcttccaaccagtaccaggaggacgtctggtcatga

DBGET integrated database retrieval system