KEGG   Podospora anserina: PODANSg7226Help
Entry
PODANSg7226       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
pan  Podospora anserina
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PODANSg7226
   03420 Nucleotide excision repair
    PODANSg7226
   03430 Mismatch repair
    PODANSg7226
   03440 Homologous recombination
    PODANSg7226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 284 aa AA seqDB search
MTSYGGYQRTGYGAQGGDEGGGFMSGSQQGSQGQSKRSTIDEYLRPVTIKQIHDAKAGYN
ESEITIDGFPVSTVTLVGQVRSVQPQTTNITYKIDDGTGGTIDVKKWVDLEKSESGAETP
FSLDTWVRVLGRLSSFNGKIHVGAHHVRVIDDYNEVSYHLLESTYVHVCISRGLPGGPWP
QKEGAAAGGHGGGDSDSMFIDSGNGYSGDAAAANARVASCSRQAKSLYQFMQSDPRSIEG
INVADVMAGSGMGKRDVLAAADELLGNGIVYTTVDDETWAILET
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatacggcgggtatcaaagaacgggctatggcgcccaaggcggtgatgagggc
ggcggcttcatgagcggttcccagcaaggcagtcagggtcaatcaaagaggagcacaatc
gacgagtacctccgcccagtaactatcaagcaaatccacgacgccaaagccggctacaac
gagtccgagatcaccatcgacggcttccccgtcagcacagtcacccttgtcggccaagtg
cgctccgtccaaccccaaaccacaaacatcacatacaagatcgacgacggcaccggcggt
accatcgacgtcaagaaatgggtcgacctcgaaaagtccgaatcaggcgccgagaccccc
tttagccttgacacctgggtccgtgttctcggtagactctcgagcttcaacggcaagatc
cacgttggcgcacaccatgtcagagtgatcgacgattataacgaggtcagctatcatttg
ttggagtctacctatgtgcatgtctgcatctcgaggggtttacctggtggtccttggcca
caaaaagagggtgcggctgctggtggtcatggtggaggggactctgacagcatgttcatc
gacagtgggaatgggtattcaggtgatgctgcggcggctaatgctagggtggcgtcttgc
tcgagacaggccaagtcgttgtatcagttcatgcagagcgatccaagatcgatagaaggg
atcaatgtcgctgatgtcatggctgggtctgggatgggcaagagggatgtgcttgcagcg
gcggatgagttgttgggcaacggtattgtctataccactgttgatgatgagacctgggcc
attctcgagacataa

DBGET integrated database retrieval system