KEGG   Podospora anserina: PODANSg7447Help
Entry
PODANSg7447       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pan  Podospora anserina
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PODANSg7447
Enzymes [BR:pan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PODANSg7447
Chromosome [BR:pan03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PODANSg7447
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PODANSg7447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
6
AA seq 865 aa AA seqDB search
YCMQSLGRVSSHQHQLTPRVPQLLHFEPNITTMADQKPPVAFIGLGAMGFGMATHLIKQG
YPVTGFDVWAPTLKRFEEAGGSTATTPAEAVLNKEHVVVMVATAQQAQTVLLDGPNAAVP
KLPQGAVVLLCSTVPCDYVQALQVQLNSIGRSDILLIDSPVSGGAARAADGTLSIMAGMS
AAALEKGRPLLAELSDPAKLYIVEGGIGAGSNMKMVHQVLAANQILGASEVMGFAERLGL
DLAKAQKAVLESDAWNFMFEHRTPRIFTEFQPVASAVQIIVKDTSIITSEGRRSSFATPM
TSAAEQIYFTAVGRGWAMDDDSSLVRLYTEGNGKVGPVYGTAESEEDKTALVLALMRGIL
LCAAAESLAFAHTVSLDLDQVLDLCVNAAGGSKVLEKLGPAIIKELGGAGDASSGESSLE
DVFSGLSAAVEEAQRIKTPLYLGTQALSILQRVTQSKGTGSAGVVVKEGYSPHQQNKPAC
PTLYCSIPIPAPSRVFSSQHASHDQISPRASSTPVEQPHQLPKMEEAMKQHFFHHGKPDT
DPSEAEKCHWCQIRSFKTHKKLPITIVNEAKGDERKEVLNPDFKFIDHSIPSDDVPIAGA
SFRTGCNCADDEQCMYSTCECLDEMAPDSDEDMSDAPPARGRRIQKFQYYHSGTKAGLLK
SRILDSREPIYECHDGCSCSKNCPNRVVERGRTVPLQIFRTKNRGWGVKCPVDIKKGQFV
DKYLGEIITSEEANRRRAESTVSDKKDVYLFALDKFSDPDSPDPLLRAPPFEVDGEWMSG
PTRFINHSCDPNMRIFARVGDAVDKHVHDLALFAIRDIPAGEELTFDYVDGGLAEEDAGG
LVPDDKKKDMTKCLCGTKKCRGFLW
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
tattgcatgcaaagtcttggccgagttagcagtcaccaacaccagttaaccccccgagtc
cctcaattgttgcactttgaaccaaacatcaccaccatggccgaccagaaaccacctgtt
gccttcatcgggctcggagccatgggcttcggcatggccacccacctcatcaagcaaggc
tacccagttaccggatttgatgtctgggccccaactctcaaacggttcgaggaagcaggc
ggctcaaccgccacaacaccagcagaagccgtcctcaacaaggagcatgtcgtcgtaatg
gtggccaccgcccagcaagcccagactgttctgctggatggccccaatgctgccgtcccg
aagcttccccaaggagccgtggtccttctctgctccaccgtcccctgtgactacgtccag
gctctccaagtccagctcaacagcatcggccgcagtgacatcttgctgatcgacagccca
gtctccggcggagccgccagagcagcagatggcactctttccatcatggcaggcatgtct
gctgctgcgttggagaaaggacgcccgttgctcgctgagctgtcagatccagcaaaactg
tacattgtcgagggtggcatcggtgctggcagcaacatgaagatggttcaccaagttctc
gcggcaaaccaaatcctgggagcaagtgaggtgatgggtttcgctgagagactaggccta
gatctggccaaggctcaaaaagcagtgctggagtctgatgcttggaatttcatgttcgag
caccgaacacccagaatattcaccgagttccagcctgttgccagtgcggttcagattatc
gtcaaggataccagcatcatcacctcagaagggcgaagaagttcttttgccacgccgatg
acaagcgcagcggagcagatctacttcactgctgttgggagagggtgggcgatggacgac
gatagcagtctcgtgagactctataccgaaggaaacggaaaggttgggccagtttatggc
actgctgagtcagaggaggataagacggctttggtgttggctttgatgagaggtatcctg
ctttgtgctgctgcagagtctcttgcttttgcgcacactgtgagtctggatttggatcag
gtcttggatctttgtgtcaacgctgctggtggtagcaaagtgctggagaagcttgggcct
gccattatcaaggagctcgggggtgccggcgatgcttcaagtggcgagtcgagccttgag
gatgtctttagcggactgagtgcggcggtcgaggaggcacagaggataaagactccgttg
tatcttgggacccaggcgttgagtattctccaacgtgtgacacaatccaaagggacaggc
tctgctggtgttgtcgtcaaggaaggctactcaccccaccaacaaaacaaacccgcctgc
cccactttatactgctcaattccaatccctgctcctagtcgcgtcttctcatcgcaacac
gcgtctcatgatcaaatatcacccagagcatcatcaaccccagtcgaacaacctcaccaa
ctacccaaaatggaggaggcaatgaaacagcactttttccaccacggaaaaccagacacc
gacccctcagaagccgaaaaatgccactggtgccagattcgtagtttcaaaacccacaag
aaacttcccatcaccatcgtcaacgaagccaaaggagacgaacgcaaggaagtcctaaat
ccagacttcaaattcatcgaccactcaatcccaagcgacgacgtccccatcgccggggcc
tccttccgcaccggctgcaattgcgcagacgacgagcagtgcatgtactcaacatgcgaa
tgcctcgacgaaatggcccccgactccgacgaggacatgtccgacgcccccccagctcgt
ggccgcaggatacaaaagttccagtactaccactccggcaccaaagccggcttgctcaag
tctagaatcctcgacagccgtgagccaatctacgagtgtcacgatggctgcagttgcagt
aaaaactgtccgaaccgggtggtggaacgaggcaggacggtgccgttgcagatcttccgg
acaaagaatagaggatggggggtcaagtgtccggtggatatcaagaaggggcagtttgtg
gataagtacttgggggagatcatcaccagcgaggaggccaaccgccggcgagctgagtcg
accgtctcggataagaaggacgtttatttgtttgctttggacaaattttctgacccggat
tcacctgacccgttgttgagggcgccgccgttcgaggtggatggggagtggatgagtggg
ccgacgaggtttatcaaccacagttgcgacccaaatatgcggatttttgctagggtgggg
gatgcggtggataagcatgttcacgatttggcgctgtttgccatcagagatataccggcg
ggagaggagttgacgtttgactatgtggatggcgggttggcggaggaggacgccggggga
ttggtaccggatgacaagaagaaggatatgacgaagtgtttgtgtgggacgaagaagtgt
agggggttcttatggtga

DBGET integrated database retrieval system