KEGG   Podospora anserina: PODANSg7693Help
Entry
PODANSg7693       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pan  Podospora anserina
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PODANSg7693
  Lipid metabolism
   00561 Glycerolipid metabolism
    PODANSg7693
   00600 Sphingolipid metabolism
    PODANSg7693
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    PODANSg7693
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PODANSg7693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 421 aa AA seqDB search
MKSWKVALLPALANTRLTVALDNGVGLKPHMGWSSWNVAQCNAASARYALATADKFISLG
LKDLGYEYINIDDCWSTKSRDSSGRLVPDPAKWPNGIKAVTDRIHSMGLKFGLYGCAGDK
TCAGYPGNEGHERGDVDQLVSWGVDFWKYDNCYTPCRQNPRPQTCTSPAGSTKTWYAPMR
DAILGVQNTKKLHFNLCNWGRDEVWTWGASYGHSWRYVVIAHHQHPLPRLTDSRMSVDNW
GDWASVERIGNAAAGIYQYSAPGGFNDLDMLYLGSSKLNTNQEKLHFGLWAITKSPLVLG
LDLEKISNSTLDIIRNKGLIDINQDSLGKAATTFRPPGAPAPVNGKIYPYWAGPLSDGVV
VGLCAGTSAGTYSVNFKDVPGLGGSGSYEWREMYTGQTGKGTSASFNIGLHDMRVIKVMK
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctggaaggttgcactactacccgcactcgccaatacccggctgacggtggca
ttggataatggagttgggttgaaacctcatatgggttggagcagctggaatgtcgcccaa
tgcaacgcagcctcagccaggtatgccctcgcaacggcagacaagttcatttctcttgga
ctcaaggaccttgggtatgaatacatcaacatcgacgactgctggtccaccaagagccgt
gacagctctggaaggctcgtacccgacccagccaaatggcccaacggcatcaaagccgtc
accgacaggatccacagcatgggactcaagttcggcctgtacggctgcgctggcgacaag
acgtgcgctggatacccaggaaacgagggccacgaaaggggtgatgttgaccagttggtg
agttggggagtcgacttctggaagtacgacaactgctacacaccctgccgtcaaaatcct
cgccctcaaacttgtaccagcccggccggcagcaccaagacttggtacgcgcccatgaga
gacgccatcctcggagttcagaacaccaaaaagctgcatttcaacctctgcaactggggc
cgtgacgaagtctggacttggggtgctagctacggtcactcatggaggtacgtcgtaatc
gcccaccatcaacaccccttaccaaggctaacagatagcagaatgagcgtagacaactgg
ggcgactgggccagtgtcgagcgcatcggcaatgcagccgccgggatctaccagtacagt
gctccaggcggcttcaacgacctcgacatgctctaccttggatcctccaagctcaacaca
aaccaggagaaattgcactttggtctctgggccatcaccaagtctcctctcgtactgggc
ttggatctcgaaaagatttccaactccaccctggacatcatccggaacaagggcttgatt
gacatcaaccaggactctctcggcaaggcggcaacaacctttcgacctcccggtgcgcca
gcaccagtaaatggcaaaatctacccgtattgggctgggccgctgtcggatggtgtggtt
gttgggctttgtgctggcacttcggcgggaacctacagcgtcaactttaaggatgtccct
ggcttgggtggctctggatcgtatgagtggagggagatgtatactggccagactgggaaa
gggacgagtgcttcgttcaatatcggcctgcacgatatgcgcgtcatcaaggtcatgaag
gtttag

DBGET integrated database retrieval system