KEGG   Podospora anserina: PODANSg7722Help
Entry
PODANSg7722       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pan  Podospora anserina
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pan00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 194 aa AA seqDB search
MAPVPDSRPIVISGPSGVGKGTLYGRLFQNHPDTFTLSVSHTTRGPRPGETDGVHYHFVT
KEAFEALKAADGFVESAKFGDNYYGTSKQTIEEQKAKGKVTVLDIEVEGVKQIQAQNYPA
RYVFIAPPNEQALEQRLRGRGTESEESIQKRLKQAKVELEYAKVPGVHEKIIVNDDLEKA
YKELEEFVFAESKA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctccagtccctgattctcgtcctatcgttatctccggcccctccggcgtcggaaag
ggaactctctacggccgcttgttccaaaaccaccccgacacattcactctttccgtttcg
cacaccacacgtggcccccgccccggtgagaccgatggtgtccactaccacttcgtaaca
aaggaggcgttcgaggcgctcaaggcagctgatgggttcgtcgagagcgccaagtttggc
gacaactactacggtacctcaaagcagacgatcgaagagcaaaaggccaagggcaaggtc
accgtgcttgatatcgaggtcgaaggcgtgaagcagatccaggcgcaaaactaccccgcg
cggtatgtcttcattgcgccgcctaacgagcaggcgctggagcagagactgagagggaga
ggcaccgagagcgaggagagcatccagaagaggctaaagcaggccaaggttgagctcgag
tatgccaaagtgccgggagtgcatgagaagatcattgtcaacgatgatctggaaaaggcg
tacaaggagctggaggagtttgtctttgcggaatccaaggcgtaa

DBGET integrated database retrieval system