KEGG   Podospora anserina: PODANSg7722Help
Entry
PODANSg7722       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pan  Podospora anserina
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PODANSg7722
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PODANSg7722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 194 aa AA seqDB search
MAPVPDSRPIVISGPSGVGKGTLYGRLFQNHPDTFTLSVSHTTRGPRPGETDGVHYHFVT
KEAFEALKAADGFVESAKFGDNYYGTSKQTIEEQKAKGKVTVLDIEVEGVKQIQAQNYPA
RYVFIAPPNEQALEQRLRGRGTESEESIQKRLKQAKVELEYAKVPGVHEKIIVNDDLEKA
YKELEEFVFAESKA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctccagtccctgattctcgtcctatcgttatctccggcccctccggcgtcggaaag
ggaactctctacggccgcttgttccaaaaccaccccgacacattcactctttccgtttcg
cacaccacacgtggcccccgccccggtgagaccgatggtgtccactaccacttcgtaaca
aaggaggcgttcgaggcgctcaaggcagctgatgggttcgtcgagagcgccaagtttggc
gacaactactacggtacctcaaagcagacgatcgaagagcaaaaggccaagggcaaggtc
accgtgcttgatatcgaggtcgaaggcgtgaagcagatccaggcgcaaaactaccccgcg
cggtatgtcttcattgcgccgcctaacgagcaggcgctggagcagagactgagagggaga
ggcaccgagagcgaggagagcatccagaagaggctaaagcaggccaaggttgagctcgag
tatgccaaagtgccgggagtgcatgagaagatcattgtcaacgatgatctggaaaaggcg
tacaaggagctggaggagtttgtctttgcggaatccaaggcgtaa

DBGET integrated database retrieval system