KEGG   Podospora anserina: PODANSg7751Help
Entry
PODANSg7751       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
pan  Podospora anserina
Pathway
pan00350  Tyrosine metabolism
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PODANSg7751
Enzymes [BR:pan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     PODANSg7751
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PODANSg7751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_24 Methyltransf_3 PCMT
Motif
Other DBs
NCBI-GeneID: 6194754
NCBI-ProteinID: XP_001910712
UniProt: B2B412
Position
6
AA seq 268 aa AA seqDB search
MGATPVSVEHTTYNPDAVYLSWEVDGKFFGDGREVALLEYIYARPDLEKLRGNPQKVLQA
IDDYGRSVRGLINIGSMKGSIVCDIIARHRPAVVLELGGYIGYSAIMFGHAMRQAGGKQY
YSVEKSPLFAAVATSLIDLAGLRDHVRVVVGTGAEGTRRLYEEGKISRVDMAFFDHFKPA
YTDDLKLCERLGVVGPGTLIVADNMVLPGNPRYLEWVHASVERKREMDKGAAEKGNPNLQ
YRNQSISSWEPSGQEDAMEITECYGIED
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccactccagtttccgtggaacacaccacgtacaaccctgacgccgtctacctc
tcatgggaagtggacgggaaattcttcggcgatgggcgtgaagttgccctcctcgagtac
atctacgctcggccggatcttgagaagctgagaggcaacccccagaaggttctgcaagcc
atcgacgattacggtcggtccgtcagaggtctgatcaacatcgggtccatgaaaggatcc
atcgtttgcgacattatcgctagacacagacctgcagtggtactcgaactgggcggttac
attggatactcggccattatgtttggacatgccatgagacaggctggtggaaagcagtac
tacagtgtcgagaagagtcctctctttgctgctgtagccacaagcttgattgacctcgcc
ggcctcagagaccatgtcagggttgtggttgggacgggggcggaaggaactcggcgcttg
tacgaggaagggaagatttctcgtgtcgatatggccttcttcgaccacttcaagccagcc
tacactgatgacctcaagctatgtgagcggctcggtgtcgtagggccggggaccctgatt
gtggcggacaacatggtgctaccggggaacccgcgttatctcgagtgggtgcatgcaagc
gtggaaaggaagcgcgagatggacaagggggcggccgaaaagggaaacccaaacctgcag
tatcgcaaccaatctatctccagttgggaaccatctgggcaggaggacgcgatggagatt
acggaatgctatggtatcgaggattag

DBGET integrated database retrieval system