KEGG   Podospora anserina: PODANSg7848Help
Entry
PODANSg7848       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PODANSg7848
Protein kinases [BR:pan01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PODANSg7848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1401 aa AA seqDB search
MLSASSSNNHSLFSFGAGNGVSNNVTDIANASFEFLPSVSFDDLQSSLESASTDFKLTQF
PSPTGQGTILGDRSAGNNHNMVERLDMTRPSAAAHALPQQPAITRSRTGSILRRPSTSSR
PPQPSTASTPSGNPGVPNAPTAPAVMRARRQSHYPPVSNPNPAKPPRKSTGDVQLGEAQV
KEVQTRKRRPSAVSLSDRPVLEASRASVDVAPRSTVVESMRHLTSSRASKARSVQPLPRS
NQDMLTPDTTLKPEHTHIAMAMPRSPNRVAAKGSTPSSAKRISVMPGTHHASHATGLGAR
TISPTDTRRMKRLSTMHHVQQGPVAGASAALPHPPPISADGRASSRSPSMLPRKISTPSS
SRTTPDHTRKSYSSGLSVNSSTSLNTVRTSTGSMQQRAMQGANSSRLPAPKALNLHNSAS
FDSSEEVPPVPAIPKAYESPKEAHLEAASFLEKRRSNLAYDASSIHSNSTASISGAQTSD
SAPAKLQRKPSNRKTVHTSKLDLEKNPAAAQSKKSLQPLRLPPITLGPLSTPTAAKIAAL
QTHGDRNLSPPPSRQIPKTPTTPMTASKGTFFGRIRPEDRADIQHLRSSASVQRLHRESP
ATTAEPPTSSTESFAGVKNGTARSGPSPFLSQSVPKGGNFETTLFKRSKTGGDFTQPLDA
AADVPVQHNKPSGPRAQKSVVTRPAGGNSPPPRPSPEEPPTPSSMSSLRRKLSLSWKRSA
SKASGSQGHHGEQNAVKHDSMPPPRIPVSATLNNLPTGKPPSPTPSTKSNGNGTYLESRR
RKSSASSLNAVLSGERNRGDTGTAAKKDSTLGTVNERATVPHNSSVVQRILKPKGSTATL
RHHDVWNSELDKDDLIAEDEMRKLGSRRKDTELAARTLDALRKRASAKERVSPQEAIRIA
VLNIYERGEIVDYKDIYFCGTQNAAKVVGDVQSESPNFGYDDERGDYSIVPGDHLAYRYE
IIDVLGKGSFGQVVRCIDHKTGVLVAVKIIRNKKRFHQQALVEVNILQKLREWDPKNKHS
MVNFTHSFYFRGHLCISTELLDMNLYEFIKSNAFRGFSLKLIRRFTKQMLSSLNLLKQHK
VIHCDLKPENILLRHPLHSEIKVIDFGSSCFETEKVYTYIQSRFYRSPEVILGMQYGLPI
DMWSLGCILAELYTGVPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRKKLFFDSMGKPR
LTVSSKGRRRRPSSKTLQQVLKCDDEAFLDFIARCLRWDPDRRMKPEEAIRHEFITGQKT
SVPIRMREGSPSKRTNSISAPRPLPEPPAAVRAATMRAREASGPNNGSVGTKTGSMPTAT
ARRTSNMSTASSMNGSISSVKRTSNGTTTTYTNGNGTIGPSSLPRASLRSVSGGVGPVGL
SNNSKTDLAAAGANAAMSRRA
NT seq 4206 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtgcctcctcttccaacaaccactccctcttctctttcggggctgggaatggc
gtgtccaataacgtgaccgacatcgccaacgcatccttcgagtttctgccctcggtcagc
ttcgacgacctccagagcagcctcgagtctgcctcgaccgacttcaaactcacgcaattt
ccttcaccgactgggcagggaacaattttgggcgatcgaagtgcgggcaacaaccacaac
atggtcgagcgcctcgacatgacacggccaagcgccgctgcccatgccttgcctcagcag
cctgccatcacgcgttcacgaacaggctcaattctacgaagacctagcacgtcaagcagg
ccgcctcaacctagcactgcttctacgccatctggtaacccaggcgtgcccaatgctccc
actgctccggctgtcatgcgtgcgcgccgacaaagtcattatcccccagtctccaacccc
aatcccgccaagccgccacggaagtcaactggagatgttcagctgggagaggctcaggtc
aaagaggttcagacccgaaagcggagacctagtgcggtgtctttatcagacaggcccgtc
ctcgaggcttcgagagcgtcggtggatgttgcacctcgatctacggtagtggagagcatg
cggcacctgacaagctcgagagcatccaaggcaaggtctgtgcagccattgcccagatcc
aaccaggatatgctcacaccagacaccacgctcaaacccgaacatactcacatagccatg
gcaatgcctcgctcccccaacagagttgccgccaagggttctactccaagctcagcgaag
cggatatctgtcatgccaggaactcatcatgccagtcacgccactggactgggtgcacga
actatcagccctaccgatacaagacgaatgaaacgcctatctacgatgcaccacgttcaa
cagggccctgttgctggcgcttccgccgcgctgccccatccaccacctatttcggccgac
ggtcgcgcctcgtctcgatccccttctatgctgcctcgaaagatctcgaccccttcgtct
tcacgaaccacgcccgaccacaccagaaagtcatacagctcaggtctgtccgtcaactca
agcaccagtctcaacacggtgcggacgtccactggctctatgcagcagcgagccatgcaa
ggtgcaaacagttcgcgattgcctgcccccaaggcgctcaatcttcacaattcggcgagc
tttgacagcagcgaggaagtgccaccggtgcccgcgattccaaaggcgtacgagtctcca
aaggaggcgcatctcgaagctgcttcgtttctggagaagaggaggtccaacctggcctat
gatgccagcagcatccatagcaattcgacagcgagtatatcgggcgcgcagacgagtgat
tcagcacctgccaagcttcaacgtaagccaagtaacaggaagacagtacacacctcgaag
ctggatctcgagaagaatcctgcggcagctcagtcgaagaagagcttgcaaccgctgcgg
ttgccgcccatcacccttggtcccctcagcaccccaaccgcggccaagattgctgctctt
caaactcatggtgacagaaatctctccccgcccccatcaaggcagatcccaaaaacgccg
acgactcccatgacggcatcgaagggcacattttttggaagaatacggcctgaagacagg
gccgatatacagcatctcaggagcagcgcgtcggtgcagaggctccatcgtgaaagtcct
gccactacggcagagccacccaccagttctactgagtcctttgccggtgtgaagaatgga
accgccagatcagggccgtcgcctttcttgagccagtcggtgccgaaaggagggaacttc
gagactactttgttcaaaaggtcaaaaactggcggggatttcacccagcctttggatgca
gcagcagacgtgccagttcaacacaacaagccctcggggccccgagcgcaaaagtctgtc
gtgacacggcctgcaggtggaaattccccgccaccgcgtcccagtccggaggagccgccc
actccttcttccatgagctctctcaggcgcaaattgagcttgtcctggaagagaagcgcc
tccaaagccagcggaagccaaggacatcacggagagcaaaacgccgtcaagcatgattca
atgccaccgccgaggattcctgtctcggcaactctgaacaaccttcccaccggcaagcct
ccaagtcccactccgtccacgaaatccaatggcaatgggacatatctggagtcacgaaga
cggaagagctcggcctccagcttgaatgcggtgctttctggggaacgaaatcgcggtgat
accggtacagcagctaagaaggattcgaccctgggaacagtgaacgagcgtgccacggtt
ccccacaactcgtctgtggtgcaaaggatactgaaacctaagggctctacggcaactctt
cgacaccacgacgtttggaattcggaactcgacaaggacgatttgattgcagaagacgag
atgaggaagcttggttcacggcgtaaggatactgagctggcagccagaactttggatgct
ctccgcaaacgtgcctcggccaaggagcgcgtcagccctcaagaagccatcagaattgca
gttctcaatatctacgaacggggagagattgtggactataaggacatctacttttgcggc
acacaaaacgcggcaaaggttgtgggtgatgttcagtcggagagtcccaatttcggctac
gacgatgagcgcggtgactacagcatcgtacccggtgaccatcttgcgtatcgctatgaa
atcatagacgtgctcggaaaaggaagtttcggtcaggtggtacggtgtatcgaccataag
actggcgttctcgtggccgtcaaaatcatccgcaacaagaaaaggttccatcagcaagcc
ctggttgaggtcaatattttacagaaactccgcgaatgggatcccaaaaacaaacacagc
atggtcaactttacgcacagcttttacttccgaggacatctttgcatctccaccgaacta
ttggacatgaacctctacgaattcatcaaatcgaacgctttccggggtttctcactgaag
ctgatccgcagatttaccaagcagatgctgagctcgctcaacctactaaagcagcacaag
gttatccactgcgacttgaagcccgaaaatattctcttgcgccaccctcttcactcggag
atcaaggttattgatttcggttcgagttgttttgaaacggaaaaggtgtacacgtacatt
cagtcccggttctaccgttcccccgaagttatccttggtatgcagtacggtctgcccatc
gacatgtggtctctgggttgcattctcgccgagctctatacgggtgtgccaattttccct
ggcgagaacgagcaggagcagctggcctgtattatggaagtgtttggcccaccggaaaag
catctcatcgagaagtcgacacgtaagaagttgtttttcgacagcatgggcaaacctcgc
ctcaccgtctcctcaaagggccgtcgcagacgcccatcctcaaaaacactacaacaagtg
ctcaagtgcgacgatgaagcatttttggactttatcgcacgctgcctccgctgggatccc
gaccgccgcatgaagcctgaagaggcgattcgccacgagttcatcactggccagaagaca
tctgtccccatcagaatgcgcgaagggtcccccagcaagcgtaccaatagcatctcggcc
cccagaccccttcccgagcctccagcagccgtgagggccgctactatgcgagcgcgggag
gcttccggtcccaacaacgggtcggtcggtacgaaaaccggaagcatgccaacagccacg
gcccgtaggacctccaacatgagcaccgcatctagcatgaatggcagtatctccagtgtg
aagcgtacgagtaacggaaccacaacgacttataccaacggcaatggcaccatcggcccc
agcagtttacctagagcatctctgcgcagcgtgagtggtggggttgggcctgtgggcctg
tccaacaactccaaaacagaccttgccgcagcaggtgcaaacgcagccatgagtcgccgc
gcatag

DBGET integrated database retrieval system