KEGG   Podospora anserina: PODANSg7868Help
Entry
PODANSg7868       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pan  Podospora anserina
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pan00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PODANSg7868
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PODANSg7868
Protein kinases [BR:pan01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PODANSg7868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 416 aa AA seqDB search
MADAFAPRSMKRKNVKGLALTPAAPKPPPTAENARPKGEDEQLEIGIEFNLDLKPEDLEI
IKDLGAGNGGTVSKVKHIPTNTVMARKIIHVEAKKEMRKRIVRELQIMRGCHSDYIVTFY
GAFLNENNDVIMCMEYMDVGSLDRVSRVFGPVRVDVLGKIAEATLGGLTYLYSKHHIMHR
DIKPSNILVNSRGSIKLCDFGVSGELINSIADTFVGTSTYMAPERIQGEKYTVKSDVWSF
GLSIMELAIGKFPFAAADQLSDAESAPAGILDLLQQIVHEPAPRLPKSDAFPQILDDMIQ
KCLYKEPERRPTPQELFDRDPFVQAAKRTPVDLREWACGLMDRDNRKSHLAPQLSPAIQD
LLRSSDSPSYPAQNEGGVQQTPTSAYRHDPRHAAAADQSALAAQVERMYIRDWDRE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcattcgccccgcgctctatgaagcgcaagaacgtcaagggtcttgctctg
acacctgccgcccctaagcctcccccgaccgccgagaatgctcgcccaaagggggaagac
gaacagctagaaattggtatcgagttcaacttggacttgaagcctgaagacctggagatc
atcaaggatcttggagctggcaatggtggaaccgtcagcaaagtcaagcatatcccgacc
aacacagtgatggcccgcaagatcattcatgtcgaggccaagaaggagatgcggaagcgc
atagttcgtgagcttcagattatgcgtggctgccattccgactacatcgtgaccttctac
ggcgctttcctgaacgagaacaacgatgtgatcatgtgcatggagtacatggatgtcggc
tctctggacagggtatcacgagtattcggtcccgtccgtgtggatgttttgggcaagatc
gccgaggcgactcttggaggtcttacatacctctactcaaaacaccacatcatgcaccgc
gacatcaagccctccaacatcctcgtcaactcgcgaggatccatcaagctctgcgatttt
ggcgtatccggtgagctcatcaactcgatcgctgacacctttgtcggtacgtcaacatac
atggcccctgaaagaattcagggtgagaagtatacggtcaagtcagatgtgtggagtttc
ggcttgtccatcatggaactggctattggaaagttcccattcgccgcagcggaccaactc
tctgatgccgagagcgcccctgccggtattcttgacctgcttcagcagattgtacacgag
cccgcgcccaggctacccaagagcgacgccttccctcagattcttgatgatatgattcag
aagtgtctgtacaaggaacccgagcgccgaccaacccctcaagagctttttgaccgcgat
ccttttgtacaagcagccaagagaacacctgtggatctgagggaatgggcctgcggtctt
atggatagggacaaccgcaagtcccatctggcaccgcagctctctccggctatccaggat
ctcctgcgctccagtgattcgccatcgtacccagcacagaatgaggggggggttcagcaa
acacccacttcagcgtaccgacacgacccccgccacgcagcggcagcggatcaatcagcc
ttggccgcgcaggtggagcgaatgtacatccgggactgggaccgcgagtag

DBGET integrated database retrieval system