KEGG   Podospora anserina: PODANSg7923Help
Entry
PODANSg7923       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pan  Podospora anserina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PODANSg7923
Enzymes [BR:pan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PODANSg7923
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PODANSg7923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 385 aa AA seqDB search
MSFSSLVQDLSLRDNGVARRRGDASVSTVNDTASRTSHISRAMSYASTSATSVSISGDIS
SQLHAGYSHPLARSWQAERQLTKSMLIYPLFVSDQDDEEVLIPSLPCQYRRGVNRLIPYL
EPLVQKGLRSVILFGVPLRPGTKDALGTSADDPQGPVIRSIQLLRQRFPHLYIVADVCLC
EYTSHGHCGILRDDGSLNNQLSVDRISDVAVSYARAGAHCVAPSDMNDGRIRAIKLKLIE
EGIVHNVTLMSYAAKFSGCLYGPFRDAAGSAPSFGDRRCYQLPPGGRGLARRAIIRDISE
GADIIMVKPASQYLDVISDAKELGKDLPIAAYQVSGEFAMIHAAAKAGVFDLKAMAFEST
EGILRAGATIIISYFTPEFLDWLSN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctctagcctcgttcaggacttgtccctccgcgacaacggtgtagcgcgcaga
cgaggtgacgcctccgtttcgaccgtcaacgacactgcttcccgcacatcgcacatctcg
agagccatgtcgtacgccagcacttctgccacgagcgtcagcatctctggtgatatctcg
agtcagctgcatgctggttacagccatcctcttgcgcggtcatggcaggccgagcgccaa
ttgaccaagtccatgctcatctacccccttttcgtgtctgatcaagacgatgaggaggtg
cttattccctctctcccgtgccaataccgccgcggtgtcaacaggctcattccgtacctt
gagccgctcgtccagaaaggtctccgttccgtcatcctgttcggtgtgccattgagacca
gggaccaaggacgcccttggcacctccgccgacgacccgcaaggtcccgtcattcgcagc
atccagcttctgcgccaaagattcccccatctttatatcgttgccgatgtctgcctttgc
gagtacacttcccatggccactgcggtatcttgagggacgatggcagcctgaacaaccag
ctgtctgttgaccgtatctccgacgttgcggtctcgtacgctcgggctggcgctcactgc
gttgcgccttcagacatgaacgacggccgcatccgggccatcaagctcaagttgattgag
gagggtattgtgcacaatgtgacgctcatgtcgtatgctgccaagttttccggatgtctt
tacggacccttccgcgatgctgctggctcggcgccctcgtttggtgaccgtagatgctac
cagctcccccctggaggtcgtggcctcgctcgtcgggccatcatccgtgatatcagcgag
ggagccgatatcatcatggtcaagccggcttctcagtacctggacgttatcagcgatgct
aaggagctcggcaaggacctgcccattgcggcctaccaggtcagcggcgagtttgccatg
attcacgcggcggccaaggctggtgtttttgacctcaaggccatggcgtttgagagcaca
gagggcattctcagggcgggagcgaccatcatcatcagctacttcacaccagaattcctg
gactggctgagcaattga

DBGET integrated database retrieval system