KEGG   Podospora anserina: PODANSg8027Help
Entry
PODANSg8027       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pan  Podospora anserina
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PODANSg8027
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    PODANSg8027
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     PODANSg8027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1125 aa AA seqDB search
MSVSTDSPRPLLPSTSSPMTPDLLQSRRSSRPSQVRTDLVPPSHAQLVVIPPSAVSNSSA
STMWPSSQHGSPTQSMEAVASLTTASSLQGSPDSLEPGQEKGLELVTPLQLPEAIVSKQP
DQTTTTLSRRTSNTSLGSTLKSPLGSTTAMAEASKSMSLIRRTSSSLRNRANGLFPRRGS
STHPRSRDGSVGPGVMRRRGSMSNPGTPYDNISPFETDSDDDVVLVGVDEVFGGDGAIRE
PSPLASTPLAASFGSVPLSLRQGTPLTKITKKNNRKRIVLTLDPDSAKIWWDRTKASKCV
YVDDIKEIRMAGDIGQYLLDAKLEEKDRPRFFSLMYAVPGKPGVTKWLHLITDTDKAFYD
WTQTLGAFSQYRQDFAASLMAFNDDAVRVYWDREMEKRFGAVRFKEAEQIEFADVERVCR
NLHIHASTDSLRKIFNTIKGKPLSYSQSSNPGLNFDEFLEFVRMMKAREDIRRVYQEHTA
SQESGMTKPEFLQFLRLVQCENVDEDLATWEATFARFARRGKAKDAESQGDAGLIMSEAA
FASYLSSSSNAVIPKAPQKYDLNRPINEYYISSSHNTYLLGRQVAGTSSVEGYISALMGG
CRCVEVDCWDGADDQPVVSHGHTMTTRISFLEVIKTINKYAFVKSRFPLWISLEVRCSQA
TQVNMAKIMIEIFGDKLVQKPLESFTDRLPTPSDLLERILIKVKKPQQPDPVERVGRRRG
NSMPSPFQRPLPDNGPVPSSPLLSPTAMARTNRINTITEGKVHDTPSSSPSECDSESEKD
SARKVVNSKISPVLGALGVYCVGIQFDGFDTQEAKSFNHIFSFKEKTFAEKNQPGPSKQA
LYRHNMRHLMRVYPNGGRITSSNFDPLIYWKRGVQMAALNWQTFDLGMQLNQAMFAGGTD
QSGYVLKPLEGRQIQLMPNLTADECVGKRPRKRVSFDIDVISAQQLMRPLNLGEKRTLDP
YVEVEVFLADDKRNKNNAVSNVTVEESKRTYRSKFVRDNGFNPEFNMSCSFDLTTKYPDL
IFVRFKVKQAESKGYNDKSPPLATYTAKLSNLKQGYRTIPLLNKEGEQFLFSTLFVKIRK
GPVEVFMADYQEEVPKNGNRLKNIGRNVFNQSNTSPKSSMDSGRS
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtctctaccgattcaccgcgtccattactgccctccacctcttctcccatgact
cccgatctcctccagagcaggcgttcttcacgccccagccaggtccggacggacctggtc
cctccatcacatgcccagctcgtcgttataccaccatcagcagtcagcaactcgtccgcc
tccaccatgtggccaagctcgcaacatggctcgccaacccagtctatggaggctgttgcc
agtctcacgacggccagctccctacagggctcaccagactcgctggagccggggcaggaa
aaggggcttgagctcgtcacccctttgcagcttccggaggccattgtctcgaagcagccc
gaccagactaccaccacattgtctcgaagaaccagcaacacctcactcggcagcaccctg
aagagcccccttggaagcacaacggccatggctgaggctagcaagtcgatgagcctgatc
cgtcgaacctcgagctcgcttcgtaatagggccaatggcctgttccctcgaaggggttcc
tcaacccatccaaggagccgggatgggagcgttggtcccggtgtcatgcgaaggaggggc
agtatgagcaatcccggtaccccctatgacaatatcagtcccttcgagactgattcagat
gatgatgtggtactcgtgggcgtcgatgaagtatttggcggtgatggggccatccgagaa
ccaagccctcttgcttcaacaccattggccgcgagttttggctccgttccgctctccctc
cgccaagggacaccactgacgaaaatcaccaaaaagaacaaccgaaagcgtatcgttctg
actctagaccccgattcggccaaaatctggtgggatcggaccaaggcatccaagtgtgtc
tatgtcgacgacatcaaggagattcgcatggcgggagacattggacagtacttgctcgat
gcgaaactcgaagaaaaggacaggcccaggttcttctccttgatgtatgcggttccaggg
aagccaggggtaacaaagtggctacacctcatcaccgacacagacaaggccttctacgac
tggacccagacacttggagccttctcccagtaccggcaagattttgcggccagccttatg
gctttcaatgacgatgctgttcgtgtttattgggaccgggagatggaaaagcggttcggt
gcggtgcgtttcaaggaggccgaacaaatcgaatttgccgatgttgaacgtgtgtgccga
aacctgcacattcatgcgtcgaccgactcactgcggaaaatcttcaacactatcaagggc
aagcccctgtcgtactcccagagcagcaaccctggcctcaactttgatgaatttcttgaa
tttgtacgaatgatgaaggcgcgagaagacatccgccgcgtatatcaagaacacaccgcg
agtcaggagagtggtatgaccaagcccgagttcttgcagttcttgcgactagtgcagtgt
gagaatgtcgacgaggacttggcaacttgggaggccacattcgctcgctttgcgcgcagg
ggcaaagcgaaggatgccgagtctcagggtgatgcaggtcttatcatgtcagaggccgcg
tttgccagttatctttcatcttcttccaatgccgtcattcccaaagcaccacaaaagtac
gacctgaacagaccaatcaacgagtactacatttccagctcccacaacacctacttgctc
ggtcgtcaagtagcaggcacctctagcgtagagggctacatctctgcactgatgggaggt
tgccgatgtgtcgaggtcgattgctgggatggtgctgatgatcagcccgtcgtctcgcat
ggtcatacgatgaccacgcgcatctcctttctcgaggtcatcaagaccatcaacaagtac
gcctttgtcaagtctcggtttcctctctggatctccctggaggtgcggtgcagccaagcg
acgcaggtcaacatggccaagatcatgatcgagatctttggtgacaagctggtgcaaaag
cctctcgagtccttcactgatcgcctcccaaccccgtcagatttactggagcgtatcctc
atcaaggtcaagaagccgcaacagcccgaccccgtcgagcgggttggtcgtagacgcggc
aacagcatgccttcgcctttccaacgcccactgccagacaacggaccggtcccatccagt
cccctcctgagtcccacagcgatggcccgcaccaaccgcatcaacaccattaccgagggc
aaggttcacgacacgcccagcagcagccccagcgagtgcgacagcgagagcgaaaaggat
tcggcaagaaaggtggtcaacagtaagatcagcccggtgctcggcgcgctcggagtttac
tgtgtcggtatccaattcgacggcttcgacactcaagaggccaagtcgttcaaccacatc
ttctcgttcaaagagaagacgtttgcggagaagaaccaacctggcccatcgaagcaggcg
ctctaccgccataatatgcggcacttgatgcgggtttatcctaatggtgggcgcatcaca
tccagcaacttcgacccactgatctactggaagcgcggagtgcagatggcagcgctcaac
tggcagacatttgacctcggcatgcagctaaaccaggccatgtttgctggcggaacagac
cagtcaggttatgttctgaagccattagaggggcgtcagatccagctcatgcccaacttg
accgctgatgaatgcgtgggcaaacggccgcgcaagagggtttcctttgatattgatgtt
atttcagcccagcagttgatgaggccgctcaatctcggagagaaacggacgttggatccc
tacgtcgaggttgaagtcttccttgccgacgacaagagaaacaagaacaatgccgtctcc
aacgttaccgtcgaagagtcgaagcgcacctaccgctccaagtttgttcgcgacaatggc
ttcaatcccgagttcaacatgtcgtgctcgttcgacctcaccaccaaatacccggacttg
atctttgtgaggttcaaggtcaagcaggccgaatccaagggttacaatgacaaatcccct
cctctggcaacctacactgccaagctttccaacctcaagcaaggctaccgcacaatccca
ctcctgaacaaggaaggcgaacaattcctgttctccactctcttcgtcaagatccgcaag
ggtcccgtggaggtgttcatggctgattatcaggaagaggtacccaagaacgggaacaga
ctcaagaatattggcaggaacgtcttcaaccaatccaacacgagccccaagtcaagcatg
gacagcggccgttcctga

DBGET integrated database retrieval system