KEGG   Podospora anserina: PODANSg8269Help
Entry
PODANSg8269       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PODANSg8269
Transfer RNA biogenesis [BR:pan03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PODANSg8269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 572 aa AA seqDB search
MATATITTTIRKKDANLPPENERYLRCCADVANALIEDHEASRDPSKPRKDINLNSLRSK
FAKKHKLNNVPPLTAIIAAVPEHYKKYILPRLIAKPIRTSSGIAVVAVMCKPHRCPHIAY
TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQLKALGHSVDK
VEYIIMGGTFMSLPESYRNEFISQLHNALSGYGTPDVDEAVRAGEQSSIKCVGITIETRP
DYCLASHLTDMLRYGCTRLEVGVQSLYEDVARDTNRGHTVAAVAETFCLSKDAGFKVVSH
MMPDLPNVGMERDLDQFKEYFENPDFRTDGLKIYPTLVIRGTGLYELWRTGRYKGYTPNG
LIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTSCRDVRTR
EVGVNEVKNKIRPNQIELVRRDYTANGGWETFLAYEDPKQDILVGLLRLRKCSEKYTFRP
ELTGQPTSLVRELHVYGMAVPVHARDPRKFQHQGFGTLLMEEAERIARDEHGSEKLSVIS
GVGVRSYYRKLGYWLDGPYMSKWLDGRPGPEE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctacagcaactattaccaccaccatccgcaagaaggatgcgaaccttccaccagaa
aacgagcgctatctgcggtgttgcgcagatgtcgccaacgccctgatcgaggaccacgag
gcatccagagaccccagcaagccccggaaggatatcaatctcaacagcctgcgctccaag
ttcgcaaagaagcacaagctcaacaatgtcccaccacttacggccattattgccgccgtc
cccgaacactacaagaaatacattctccccaggttgatcgcaaagcccatccgaacatcg
tcaggtatcgccgtagtggcggttatgtgcaagcctcacagatgtccacacattgcctac
acaggaaatatttgcgtctactgccccggcggcccagattccgatttcgagtacagcaca
cagtcctacaccggatatgaaccaacctctatgcgcgccatccgggctcgatacgaccca
ttcgagcaggcccgcggccgtgttgaccagctcaaggctctgggccactctgttgacaag
gtggaatatatcatcatgggcggtacctttatgtcgcttcccgaatcctaccgcaacgag
tttatctcccagcttcacaatgccctttccggatatggtacgcccgacgtcgacgaagcc
gtccgcgccggcgagcaaagcagtatcaagtgcgtcggcatcacaatcgaaaccagacca
gattactgtctcgccagtcacctaacagacatgctccgctacggctgcacccgtctcgaa
gtcggcgtgcagtccctctacgaagacgttgcccgtgacacaaacagaggtcacactgtt
gccgccgtcgcagaaacattctgcctttccaaggacgccggattcaaggtcgtttcccac
atgatgcctgatcttcccaacgtggggatggagcgcgacctggaccagttcaaggaatac
tttgagaaccctgatttccgaactgacggtctgaagatttatcctaccctcgtcatccgt
gggacaggtctctacgagctatggagaacggggagatacaagggctacacgcccaacggc
ctcatcgacctcgttgctcgcatcctggctcttgtaccgccatggacgcgtatctaccgt
gtccagagagatatcccaatgcccctcgtcacatccggtgtcgagaacggcaacctcaga
gaactcgccctggctcgcatgaaggactttggcacctcttgccgtgacgtccgcacccgc
gaagtgggtgtcaacgaagtgaaaaacaagatcagaccaaaccagatcgagctcgtgagg
agagattacaccgccaacggaggatgggagaccttcttggcctacgaagatcccaagcag
gatatcttggttggtttgcttcggctgagaaagtgcagcgagaaatacacctttaggcca
gaactcacggggcagccgacgagtttggtcagagagttgcatgtgtacggcatggctgtt
ccggtgcacgctagagatcctagaaagttccaacatcagggcttcggcacgttgctgatg
gaggaagcggagagaattgcgagggatgagcatgggagcgagaagttgagtgttatttcg
ggtgttggtgtgaggagttactacaggaagttggggtactggttggatgggccttacatg
agcaagtggctggatggaaggccggggccggaggaatag

DBGET integrated database retrieval system