KEGG   Podospora anserina: PODANSg8321Help
Entry
PODANSg8321       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PODANSg8321
Peptidases [BR:pan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PODANSg8321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 697 aa AA seqDB search
MNTEAYRRILGQVETRVGLDSQQHSTLRQLKDRAVGPIGIIITLIVVLVSWIYQIAKRQG
RVPDLSQLIWKILVAITPARLLYAMDDFLNPSLFPRPPSADRPTTHEAKSDVLKKMLGLE
TAAGILNSGIEAGRKSLTTLSTAALNLARKSSPDQPPGLLNMDNSCFQNSILQGLASLRP
FPGYLSAVSSAMTSADSFTISKLHKLVLDLNNLSNNGRTLGTPAVLKKMNTWQQQDAQEY
YSKLLDQISKEVAKSLKNPQNSPALELDWSRDDSDSSQHSDDSGYHSMESQSKYGQDICV
TRNPLEGLIAQRVACVSCGYCSGLDMIPFNCLTLNLGKRMEHDLYERLDAYTSLEAIQDV
ECTKCTLLNSRSGLQALAERANIPGLAERIQIIEEALEEEDFKDDTLKKCNIPRTQRKSS
TKTKQTSIARPPQSLVFHINRSVFDERTGRLYKNGANVRFPMELDLGPWCVGSAAGLTGR
DLSSDREEWITDPRSSMVAGGERTSRITGPIYTLRAVVAHYGRHENGHYVCFRKHPKSSS
PPAAAPEVGGATDEPPKLASEKDMSADAPSTPVTRGTLEEDLEEEQWWSLSDEDVTRVDE
DTVLAQGGVFMLFYDCVDPEQTLMTAELASCDEMQEGGVQGPVSSFLKVDGPEGEIQGPM
SFLKVDGPETPAISTEGDASLSEAAAIPLPDGNDSDY
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgaagcgtaccggcgcatactgggccaagtggaaacccgcgttggcctcgat
tcacaacagcattctactttgcgacagctcaaagaccgcgccgttggcccgataggcatt
atcataaccctcatcgtcgtcctcgtcagctggatctatcagattgctaaacggcaaggg
agggtccctgatttgtcacagcttatctggaaaatactcgtggctatcactccggccagg
ctgctttacgccatggacgactttctcaacccctccctgtttccgcggcccccgtcggcc
gatagacctacgactcatgaagctaagagcgatgttcttaagaagatgttgggcttggag
acggcggcaggaattttgaactcgggcattgaagcggggcgcaagagcttgactaccctg
tccactgcagcgttgaatctggcacgtaaaagctcgccagaccagcctccgggacttttg
aacatggacaactcttgctttcagaacagtatccttcagggactcgcgtctttgaggccc
tttccaggatatctctcagcagtctcttcagccatgacttcagccgacagcttcacgatc
agcaagcttcataagctggttctggatcttaacaacctgtcgaacaacgggagaacgctg
ggcacgccggccgttttgaagaagatgaatacctggcaacaacaggatgcccaggaatac
tactccaagcttctcgatcagatcagcaaggaggtcgcaaaaagcttgaagaatcctcag
aattccccggcattagagcttgattggtcgcgcgacgactcggactcgagccaacacagc
gatgacagcgggtaccatagcatggagagtcagtccaagtatgggcaagatatctgcgtg
actcgaaaccccctggaaggtctcatcgcccagcgtgtagcatgtgtctcatgcggctac
tgcagtggcctggacatgattcccttcaactgtttgaccctcaaccttggaaagcggatg
gagcatgatctttatgagagactggatgcctataccagccttgaggcgatccaggacgtc
gagtgtaccaagtgcaccttgcttaactcccgcagtggtctccaggctctcgcggagcga
gccaacattcctggtttggcggaaagaatccagattattgaggaggcgttggaggaggag
gatttcaaagatgatacgctgaagaagtgcaacatccctcggacacagcggaagagttct
accaagactaagcaaacgtctatcgcccgtccaccgcaaagcttggttttccacatcaac
aggtcggtgtttgacgaacgtactggtcggttatacaaaaacggagcaaatgttcggttc
cccatggagcttgacctgggcccttggtgtgttgggagtgcggcaggcctgacgggtcgg
gatctgagttcggatcgggaggagtggattacagaccctcgctcgtcgatggtggcggga
ggagaaaggacgtcccggattaccggtccgatatacacattacgggcggtggttgctcac
tatggtagacatgagaatgggcactatgtctgctttcggaaacaccccaagtcatcatca
ccgccagcggcggcaccagaagtgggaggagcgacggatgagccgcctaagcttgcgtcg
gagaaggacatgtctgcggatgcaccctcgacaccggtgactcgtgggactctggaggag
gatctggaggaggagcagtggtggtcactgagtgatgaggatgtcaccagggtggatgag
gatacggtgctggcgcagggcggggtgtttatgctgttttatgactgtgttgatcctgag
cagactttgatgactgctgagcttgcgagttgtgatgagatgcaagaggggggggttcaa
gggccggtgtcgtcgtttttgaaggtcgatggtccagaaggggaaatccaggggccgatg
tcgtttttgaaggttgatggtccggaaacgccggcgatatcaacggagggtgatgcgtcg
ttgtcagaagctgcggcgataccgttacctgacggcaatgatagtgactactga

DBGET integrated database retrieval system