KEGG   Podospora anserina: PODANSg8424Help
Entry
PODANSg8424       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
pan  Podospora anserina
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PODANSg8424
Enzymes [BR:pan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PODANSg8424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1083 aa AA seqDB search
YRAQDGQDDAPPQDPRLAKGGRLGYINVDFHHAKARLRQTPYSLKQYKYDPKTSCGPGPP
TQIVVTGFNPITPFSTVTTCFAAFGDIAESSNKLHPDNGSYLGFATFRYKDTKPNRSRPQ
VISAADAARNAVRAMNNKQIAGRLVRVDFDPDGKKSSEMLVQAIRKDSERHNSVPSTARP
IPTGPRASVPGPPPTAPRGPAAHRAPPPPPPIAGRGAGAGPVPVPGPPSTRPVYVIETES
VKETIREAPYIFVAHEYVPVQPSTVMHMRKRLKVYAIETIRADKSGYYVIFHNSDRGRHD
VERCYRACNRTPFFNYLMVMELNTYGSEGRGSRTSREPRRHSRSPERRRVDDHRSHRDHD
RGRRDEDRQKREEQDRRKREEESLLKEEKDQRAKNFDPVIEATNVVIQQMKEQLIRHIRT
KIAAPALLNFLDPANQVASRRKHNIEDPHSSKLSITFDDSDTKSPVGTPNSRADPIERRT
GRLDVSALPRIRKAKNAALNARKHAFNDPFARHRPPTQRSTFRSLHDRLQSDSDDDSDDE
VDHRYLNVRNTDEPESRPRSRSSTDDEATKEDYASWGPAEEDSMTEASFALTDGPALPRK
RKLDLQMETAIKRQKKTDEELFGVTINRVDPGYPSRELSPEDIVLPDAEPLEERDTDSSR
MPTPVPQGAKSKKKATKTKKKSKKQIFEEREALKRQQEEIFEKEASLAADEVEPTPDAEP
EPGIKEAALDEEPDVEKGEKPRKLDLDEKMYPSEKVRAFELPSNFILNETSLRASVLPAL
SHADLPNLERLKQRQGSGHLEQPQVWAWMRDRVRELNSTDGSKDTPCSIGGYYVPNTTGC
ARTEGVKKILNSEKSKYLPHHIKVQKAREERQAQNGKSGKDSVLAAAEAAKLAAESQVAR
GTSRANRANNRRFVAGLHDQIRGLGQDSDAFRFNQLKKRKKPVKFARSAIHNWGLYTMEN
IPKDDMIIEYVGEEVRQVIAELREARYLKSGIGSSYLFRIDDNTVIDATKKGGIARFINH
SCMPNCTAKIIKVEGSKRIVIYALRDIAQNEELTYDYKFEREIGATDRIPCLCGTAACKG
FLN
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
taccgcgcacaggacggtcaagatgacgctcccccccaagatccccgccttgcaaagggt
ggccgcctcggttacatcaacgtcgacttccaccatgcgaaggcacgcctgcgccagacc
ccctacagtctcaagcagtacaaatacgaccccaaaacgtcttgcgggcccggccctccg
acacaaattgtggttacggggttcaatcctatcacccctttctcgacggtcaccacctgt
tttgctgcttttggagacattgctgagagcagcaacaagctacatcccgacaatggtagt
taccttggttttgcaacctttaggtacaaagatacgaagccgaataggtcgcggcctcaa
gtcattagtgccgccgacgcagcaagaaatgcggtccgtgccatgaataacaagcagatt
gcagggcgccttgttcgagtcgacttcgaccctgacggaaagaagagctccgaaatgctc
gttcaggccatccgaaaagactcagaaagacacaacagtgtcccatcgacggcaagacct
attcctacaggcccacgggctagtgtcccaggacctcctcctactgcgccgcgaggtcca
gctgcccacagagcaccaccacctccgcctcctattgccggtcggggagcgggagcggga
ccagtaccagtgccaggaccgccatcaaccaggcccgtgtacgtgatcgagactgagagc
gtcaaggaaacgatccgggaagcgccctacatcttcgtcgcccacgagtacgttccagtc
cagccgtcaacggttatgcacatgaggaagcgccttaaagtgtacgccatcgagactatt
cgcgccgataagagtggctattacgtgatttttcacaacagcgaccggggtcgccacgat
gttgagcgttgctacagggcatgcaatcggacacctttcttcaattaccttatggtcatg
gaactcaacacctacgggtcagagggcaggggctcaaggacatctcgagagcctcgaaga
cacagtcgaagtcctgagcgcaggcgagtagacgaccatcgatcacaccgtgaccacgac
cgaggccgacgtgatgaggatcgacagaaacgggaggaacaagaccgacgaaagcgtgaa
gaggagtcactgctaaaggaagagaaggatcaaagagccaagaacttcgatcctgtaatc
gaagctaccaatgtggtaattcaacagatgaaggagcagctcatcaggcacattcgaacc
aagattgcggcgccagccttgttgaactttcttgatcctgccaaccaggtggccagccga
cggaagcacaacattgaagacccgcattcctccaagctctcgatcacttttgacgactcc
gacaccaaatcaccggttggcacaccgaattccagagcggatccaatcgagaggcgaact
ggtcgactggacgtgtctgcgcttccccgaattcgcaaagcgaaaaatgctgctctcaac
gcccgcaagcatgccttcaacgacccctttgcgcgccaccgacctcccacccaacgctcg
acgtttcgatctcttcatgaccgcctgcaaagcgatagcgatgatgactcggatgacgag
gtggatcacaggtatttgaatgttcggaataccgatgaacctgaatctcgacctcgtagc
cgctcgtccacggatgacgaggctaccaaggaagactatgcgtcatggggcccagctgag
gaagattcgatgacggaagccagctttgcgttgactgacgggccggctcttccccgaaaa
agaaagctggacttgcagatggagacggctatcaagcggcagaagaaaacggacgaggag
cttttcggagtcaccatcaaccgcgtcgacccaggttacccctcgagagagctttcgccg
gaggatattgtgctccccgatgccgaacccttggaggagagggacactgatagttcgcgg
atgccgacacctgttcctcagggggccaaatccaaaaagaaggccacgaaaaccaaaaag
aagtccaagaaacagattttcgaggaacgtgaagccctcaagcgtcagcaggaagagatc
tttgagaaggaggcctctctggctgcggatgaggtcgagccaacacccgatgctgagcct
gaaccgggcatcaaggaagctgctcttgacgaggagccagatgtcgagaaaggagagaaa
cctcggaaactggaccttgatgagaagatgtatccgtctgagaaggttcgcgcatttgag
cttccttcgaacttcattcttaacgaaacttcgcttcgggcttcggttctgcctgcactt
tcccacgctgatctgccgaatctggaaagattgaaacagaggcaggggagtggacatctg
gagcaacctcaggtctgggcgtggatgcgggaccgtgttcgtgagctaaactcaaccgat
ggttcgaaggatactccttgcagcattggcggctactatgtccccaatacaaccggctgt
gccaggaccgaaggtgtcaaaaagattctcaactcggagaagtccaagtacctgcctcac
cacatcaaggtccagaaggcccgggaggagaggcaggcgcaaaacgggaagtcgggcaag
gactcggtcctggctgccgcagaagccgcaaagttggcggcggagagccaggttgctaga
ggcacctcgcgtgccaatcgggcgaacaaccgtcgttttgtggccggtctgcatgaccag
ataaggggtctcggccaggattcggacgccttcaggttcaaccagctcaaaaaacggaag
aagcccgtcaagtttgctcggtcggccatccacaactggggactgtacaccatggagaac
attcccaaggacgacatgatcatcgaatatgtgggcgaggaagtccggcaggtgattgca
gagctccgggaggcgagatatctcaagagcggcataggtagcagttatctcttccgaatt
gatgacaacacggtcatcgacgcgaccaagaagggcggcatcgcgcggttcatcaaccac
agctgcatgcccaactgcacggccaagatcatcaaggtggagggcagcaaaaggattgtc
atttatgccctccgggacattgctcagaacgaggagctaacatacgactacaaattcgag
cgtgagataggagctacggaccgcattccctgcctatgcggaacagcggcttgcaagggc
ttcctcaactaa

DBGET integrated database retrieval system