KEGG   Podospora anserina: PODANSg845Help
Entry
PODANSg845        CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 355 aa AA seqDB search
MESETRYIGGWPFQPNRFFFNYPVIPAESHPPSKMKASLMLLLAPLVSAAPTVEHRQASQ
SIDALFKAKGKEFYGTATDQGRLQAGRNAAIIEANFGQVTPENSMKWESLNPRQGQYNWG
QADYLVNWATERNKTIRGHTFVWHSQLAGWVNQINNRDQLTRVIQEHIRTVGGRYKGKIY
HWMFNEDGSLRNSVFSRVLGESFVKIAFDAARETDPSAKLYINDYNLDQPNYAKVTRGMV
ANVNKWLSQGIPIDGIGTQGHLQSGQGNGLAQTIKVLAATSVKEVAVTELDIQNNNSNDY
VAVTRGCLEEPKCRSITVWGVRDQDSWRPQGNPLLFDSNYNAKANYNAIVQFLSQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggaatctgagactaggtatataggaggctggcccttccaacctaaccgcttctttttc
aactacccagtcatcccagccgagtctcacccaccgtcaaagatgaaggccagtcttatg
cttctgttggcaccgttggtgtcagcggctcccaccgtcgagcaccgtcaggcttcccag
agcatcgacgcgctcttcaaggccaagggcaaggagttctatggcactgccaccgatcag
ggccgtcttcaggctggccggaacgccgccattatcgaggccaacttcggtcaggtcact
cccgagaacagcatgaagtgggagagtctcaacccccgccagggccagtacaactggggc
caggctgactacctcgtcaactgggccaccgagcgcaacaagaccatccgtggccacacc
tttgtctggcactctcagctcgccggctgggtcaaccagatcaacaaccgtgaccagctc
acgcgtgtgatccaggagcacatccgcaccgtcggtggccgctacaagggcaagatctac
cactggatgttcaacgaggatggctcgctccgcaacagcgtcttctctcgtgtcctcggc
gagagcttcgttaagattgccttcgacgccgctcgcgagaccgacccctcggccaagctc
tacatcaacgactacaacctcgaccagcccaactacgccaaggtcacccgcggcatggtt
gccaacgtcaacaagtggctgtctcagggtatccccatcgacggtatcggtactcagggc
catcttcagtccggccagggcaatggtcttgcccagaccatcaaggttctcgctgccacc
agcgtcaaggaggtcgccgttaccgagctcgacatccagaacaacaacagcaacgactac
gtcgccgtgacccgtggctgcttggaggagcccaagtgccgttccattaccgtctggggt
gtccgtgaccaggattcgtggcgccctcagggcaaccctctcctgttcgacagcaactac
aacgccaaggccaactacaacgccattgtgcagttcctgtcgcagtaa

DBGET integrated database retrieval system