KEGG   Podospora anserina: PODANSg8690Help
Entry
PODANSg8690       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
pan  Podospora anserina
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PODANSg8690
  Replication and repair
   03420 Nucleotide excision repair
    PODANSg8690
Transcription machinery [BR:pan03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PODANSg8690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 453 aa AA seqDB search
LPIMATEDARYRDSSQYRLWSFSPTQLSALREKTNAAARARISERLLSHPLPVSTSKQDL
SAPTSNANTPDPDGNSTPALPEFLTPAEELTLVGYYTSEILRASEALHYADEIKATAAMF
LKRFYITNSIMTYPPAEMFFVALFFACKVDTGHVNLAEYTKIFNKSAEEILAGEFLLCQG
LRFAFDVKHPYRALRGAMMELASLPDMQKDLKRLDEAEAKARKVLQFSPLMTDAYFHYTP
SQIMLAALSLADRGLAERLIQETFHFVAAEGNDTPGGGGGDNNKGNEEKARVIGSQIRDK
VLGAIEGCRDMLSRELPERKDHWLNKQVIKTQITPLRKKLLKCKDPERWNLVELQRVRRE
QAAKKMDSDDEDDLGGGKKVKKEEDGDIFGGDLGHSAKKRKMTVKKEEDPFGGPMVKKED
PFGGPMVKKEEPFGGTKVKKEEDSSFGRFGGAL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
ctgcccatcatggcaaccgaagacgcgcgctaccgtgactcctcgcaataccgtctctgg
tccttctccccaacccagctcagcgccctccgcgaaaagaccaacgccgccgcgcgcgcg
aggatttccgagcgtttactttcccacccactccccgtctcgacatcaaagcaggacctc
tcggccccaacctccaacgccaacacccccgacccagacggaaacagcacaccggcccta
ccggagtttttgactccagcagaggagctcacgctggtggggtactacacctcggaaatc
ctccgcgcgtcggaagccctccactacgcggacgagatcaaagccacggccgccatgttc
ctaaagaggttctacatcacaaacagcatcatgacgtacccgccggcggaaatgtttttt
gtcgcgctgttttttgcgtgcaaggtcgacacgggacatgtcaatctggcggagtatact
aaaatcttcaataaatccgccgaggagatcctcgcgggggagtttcttctgtgtcagggg
ttgaggttcgcgtttgatgttaagcacccttatcgtgcgcttcggggggcgatgatggaa
ttggcgagtttgccggatatgcagaaggacttgaagaggttggatgaggcggaggcgaag
gcgaggaaggtgctgcagtttagtccgttgatgacggatgcgtactttcattacacgccg
agccagattatgcttgctgcgttgagtttggcggatagggggttggcggagaggttgatt
caggagacgtttcattttgtggcggcggaggggaatgatacccccggggggggagggggt
gataacaacaagggaaatgaggaaaaggcgagggtgattgggagtcagattagggataag
gtgctgggggctattgaggggtgtagggatatgttgagtagggagttgcctgagaggaag
gatcactggcttaataaacaagtcatcaagactcagatcacgcccctgcggaagaagctt
ctcaagtgcaaggacccggaacggtggaatttggtggagctgcagagggtgaggagggaa
caggcggcgaagaagatggactcggatgatgaagatgatcttgggggtgggaagaaggtg
aagaaggaggaggatggggatatttttgggggtgatttggggcatagtgccaagaagagg
aagatgacggtgaagaaggaggaggatccgtttgggggaccgatggtgaaaaaggaggat
ccgtttgggggaccgatggtgaaaaaggaggagccctttgggggaacgaaggtgaagaag
gaggaggattcgtcctttggaaggtttggtggggcgttgtga

DBGET integrated database retrieval system