KEGG   Podospora anserina: PODANSg8695Help
Entry
PODANSg8695       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pan  Podospora anserina
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PODANSg8695
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PODANSg8695
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PODANSg8695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 161 aa AA seqDB search
MTSSPWTACKGQEYPLSNLKDKVILIVNVASKCGFTSQYAGLQELYKNITAKHPDQFVIL
GFPCNQFGGQEPDAEAEIVTFCERNFGVTFPIMQKIEVNGDNAHPLFEWLKEQKSGLLGL
KRIKWNFEKFLIGKDGQVKGRWASVTGPASLEKEILAELEK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaagcccttggacagcatgcaagggccaagaataccccctctccaacctcaaa
gacaaagtaatcctcattgtcaacgtcgcctccaagtgcggcttcacctcacagtatgcc
ggtcttcaggagctctacaaaaacatcaccgccaagcacccagaccagttcgtcatcctt
ggcttcccctgcaaccagttcggcggccaggaacccgacgccgaggcggaaatcgtcacc
ttttgcgagcgcaactttggcgtcacctttcccattatgcaaaagattgaggtgaatggt
gacaatgcccaccccttgttcgagtggctcaaggagcaaaagtctggcctcctcgggctc
aagaggatcaagtggaactttgagaagtttttgattggcaaggacggccaggttaagggg
agatgggctagtgtgacgggcccggcttctctggagaaggagatcttggctgagttggag
aagtaa

DBGET integrated database retrieval system