KEGG   Podospora anserina: PODANSg8745Help
Entry
PODANSg8745       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
pan  Podospora anserina
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    PODANSg8745
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PODANSg8745
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.84  glucan 1,3-alpha-glucosidase
     PODANSg8745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 995 aa AA seqDB search
MHLSGPLSGRWTAYLGLISTLSGVITPAVAVKEHDFKKCAQSGFCSRNRALADHVLSTNS
WSSPYSILPESGSFKDGQYQAVVLKTINDNGDTVRLPLTVSFLESGTARVTIDEEKRQKG
EIELRHDSKARKERYNEAEKWVIVGGLTLDKEAKVDFEDKSQLTVKYGPTSNFEAVIKFA
PFGIDFKRDGVSQIKFNDQGLLNVEHWRPKIEKPAVENKDTPEGEQNQEDKEEEKKEEEE
EPKGEDESTWWDESFGSNTDSKPRGPESVGLDITFSGFEHVYGIPSHTGPLSLKTTRGGD
GSYSEPYRLYNADVFEYILDSPMTLYGSIPFMQAHRKGSSVGVFWLNAAETWVDITKGKD
SKNPLSLGIGSKTSTHTHWFSESGLLDVFVFLGPTPKDLTAKYGELTGTTTMPQEFALGY
HQCRWNYVSDEDVKDVDRKMDKFKMPYDVIWLDIEYTDDKKYFTWDEHSFRDPIGMGKQL
ESHGRQLVTIIDPHIKNTDNYPVVAELKSKDLAVKNKDGNIFEGWCWPGSSHWIDAFKPA
AREWWATLFKYASFKGSMENTWIWNDMNEPSVFNGPETTMPKDNLHDGNWEHRDVHNLNG
MTFHNATHHALKTRKPGELRRPFVLTRAFFAGSQRIGAMWTGDNTAEWGHLKESIPMILS
QNIAGFPFSGADVGGFFGNPDKQLLTRWYQAGAFYPFFRGHAHIDARRREPYLMGEPYNT
IIAGALRLRYSLLPSWYTAFHQAHVDGTPIVKPLYYTHPDEEAGFPIDNQFFVGNTGLLV
KPVTEENKETQDIFVPDNEVYYDYFTYNVVASGKAGKTVTVAAPLEKLPLLMRGGHIFPR
RDIPRRSSQLQKWDDYTLVLTIPKDGKHAEGELYVDDGDSYDFEQGQYINRRFVYDGAAK
TITSVDKEGRDTKSVKQGEWLKKYNEVRVDKIVVVGAEEKVWGKKTEVDVVDESGKGAWK
AKVEFTPADKAAGRASFAVIKRVGASIGSDWKVEL
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgcacctctcaggcccgctgtccgggaggtggacagcttatctcgggctgatatctaca
ctttccggcgtcattacaccagcagttgccgtcaaggaacatgatttcaaaaagtgcgcc
cagtcgggcttctgctcgcgaaaccgagcgcttgctgaccacgtcctctccaccaactcg
tggtcgtctccatactctatccttcccgaatccgggtccttcaaggacggacagtaccaa
gctgtcgtattgaagactatcaacgacaatggcgacaccgtccggcttccattgaccgtt
tccttcctcgaatccggcaccgcccgagttacgattgatgaagagaagaggcaaaagggc
gagatcgaactgcgccatgacagcaaggcccggaaggagcgatacaatgaagccgagaaa
tgggttattgttggagggctaacacttgacaaggaagccaaggtggatttcgaagacaag
tcacagctcactgtcaagtacggacctacctccaacttcgaagccgtcatcaagttcgct
ccctttggaatcgattttaagcgcgatggagtcagccagatcaagttcaacgaccagggg
ctgctgaacgtggagcactggaggcccaagattgagaagccagcggttgagaacaaggac
acccccgagggcgagcagaaccaggaggacaaggaagaggagaagaaggaggaggaggag
gaacccaagggcgaggacgagagcacctggtgggacgagtcctttggcagcaacaccgat
tcgaagcctcgtggccccgaaagtgttggcctcgatatcaccttctcgggcttcgagcat
gtctacggcattccttctcacaccggccctctgtcactgaagaccactcgcggcggggat
ggcagctacagcgagccctacaggctctacaacgccgacgttttcgagtacattcttgac
agcccgatgacgctttatggctccattcctttcatgcaggcccaccgcaagggctccagc
gttggtgttttctggctcaatgctgccgagacctgggtcgatatcaccaagggcaaggac
tccaagaaccccctgtctcttggtattggctccaaaaccagcacccacactcactggttc
tcggaaagtggtcttctggacgtctttgttttccttggccctacccccaaggatcttacc
gccaaatatggcgagctcaccggcaccaccaccatgcctcaggagtttgccctcggttac
catcagtgccgctggaactacgtctcggacgaggatgtcaaggatgtcgaccgcaagatg
gacaagttcaagatgccctatgatgtcatttggctcgatattgagtacacggatgataag
aagtacttcacctgggatgagcatagcttcagggaccccatcggcatgggcaagcagttg
gagagccacggtcgccagctggtcactatcatcgaccctcatatcaagaacaccgacaac
taccccgtcgttgccgagctcaagtccaaggacttggctgtcaagaacaaggatggcaac
atctttgagggctggtgctggccaggcagctcccactggattgatgctttcaagcctgcc
gcccgtgagtggtgggctaccctcttcaagtatgcctcgttcaaaggctccatggagaac
acctggatttggaacgacatgaatgagccttcggtctttaacggtcccgagacgaccatg
cccaaggacaaccttcatgatggcaactgggagcatcgtgatgtccacaaccttaacggc
atgaccttccacaacgccacacaccatgctctcaaaacccgcaagcctggcgagctccgc
cgtccatttgtcctcacccgcgccttctttgccggctctcagcgcatcggtgccatgtgg
accggtgacaacactgccgagtggggccatctcaaagaatccatccccatgattttgtcc
caaaacatcgccggcttccccttctccggcgctgacgtcggtggcttcttcggcaaccct
gacaagcagctcttgactcgttggtaccaggccggtgctttctaccccttcttccgcggc
catgctcacattgatgcccgccgccgcgagccttacctcatgggggagccgtacaacacc
atcatcgctggtgccctccgccttcgttacagccttttgccatcatggtacactgccttc
caccaagcccacgtcgacggcactcccatcgtcaagccgctgtactacactcaccctgac
gaagaggccggtttccccatcgacaaccaattcttcgtcggcaacaccggccttctcgtc
aagcctgttaccgaggagaacaaggagactcaggacatcttcgtccctgacaacgaagtc
tactacgattactttacttacaatgtcgttgcctctggcaaggccgggaagacggtcacg
gttgccgctccgctggagaagctcccccttctgatgcgtggtggccatattttcccccgc
cgtgacattccccgccgctcttcgcagctccagaagtgggatgactacactttggtgttg
accattcccaaggacggaaagcacgcggagggcgagttgtacgtggatgacggcgactcg
tatgactttgaacaggggcagtacatcaaccgcaggtttgtttacgatggcgccgccaag
accatcacgtcggttgataaggagggcagggataccaagagcgtcaagcaaggggagtgg
ctcaagaagtacaatgaggtgagggtggacaagatcgtggtcgtgggggcggaggagaag
gtgtgggggaagaagaccgaggtggatgttgttgatgagagcgggaagggggcgtggaag
gcaaaggtggagtttactcctgctgacaaggccgccgggagggcgagctttgcggttatc
aagagggtgggtgcgagcattgggagtgattggaaggttgagctctaa

DBGET integrated database retrieval system