KEGG   Podospora anserina: PODANSg8766Help
Entry
PODANSg8766       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
pan  Podospora anserina
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:pan03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 352 aa AA seqDB search
MENIWSRRPGSSKLSLSTSGSGQGDSPSGRNNSFRRIGGDSSSLQKTNPFSSITTPGGGL
ASPTGGASNAFGLGSGAFASFGSAKTPKATGNPFESSLGAAVKTPGAEKSAKEGGLAGKS
VGRVASNASLLDSARTSGASVHRLRDSWVFWFRPPISKANGFIEYENTLHPIASVDTAEN
FFGVYGHLKRPSTLPLVSDYHLFKKGIRPIWEDQENKAGGKWVVRLKKGVADRYWEDLLF
AIIGDQFGEASEEVCGIVVSIRNGEDILSIWTRSSGQRVLKLRETMRRVLSMPNDTKIEF
KSHDTSIQQRTAIEESRREKAANNHHGDKRNNKQQHYQQQLQQSNDEQQKNL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagaacatatggagtcgccgccccggttcgagcaagctctccctctctacttccggc
tccggtcagggcgacagcccctctggacgcaacaactctttcaggcgaatcggcggtgat
agctcttcgctccagaaaaccaaccccttcagttccataaccacgccgggaggcggcttg
gcgtcacctacaggcggcgcatcgaatgccttcggcctaggatctggcgcctttgcctct
tttggttcggcgaagacccctaaggcgactggaaatcctttcgagtcgtctttgggcgct
gctgtcaagacacccggtgcggagaaatctgcaaaggagggtggcttggctggcaagtct
gtcggccgggtggcatccaacgcctccctgcttgactctgccaggacgtcaggagcgtca
gtccaccggctgcgtgacagctgggtgttctggtttcgcccgcccatctccaaggcgaac
gggtttatcgagtatgagaacactctgcacccaatcgcctcggttgatacagccgagaac
ttcttcggcgtgtacgggcacttgaagcggccgtcaacactgccgctggtatcggactac
cacctcttcaagaagggaatccggccaatatgggaggaccaggagaacaaggcgggtggc
aagtgggtggtgcgcctcaagaagggcgttgcggaccgctattgggaggacctgctgttt
gccattattggcgaccagttcggcgaggccagtgaggaggtttgcggtattgtggtgagc
atccgtaacggggaggacatcctcagcatctggactcgttcgagtggacagcgggtcctg
aagctccgcgaaactatgcgccgagtcctgtcgatgccaaatgacaccaaaatcgagttc
aagagccacgacaccagcatccagcagcgcactgctattgaagagtcccggcgggagaag
gcggcgaacaatcaccacggtgacaagcgcaacaacaagcagcaacattatcagcagcag
ttgcagcagtcgaatgacgaacagcagaagaacttataa

DBGET integrated database retrieval system