KEGG   Podospora anserina: PODANSg8766Help
Entry
PODANSg8766       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
pan  Podospora anserina
Pathway
pan03013  RNA transport
Module
pan_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PODANSg8766
Messenger RNA biogenesis [BR:pan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     PODANSg8766
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PODANSg8766
Translation factors [BR:pan03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PODANSg8766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 6195979
NCBI-ProteinID: XP_001911721
UniProt: B2B6X1
Position
2
AA seq 352 aa AA seqDB search
MENIWSRRPGSSKLSLSTSGSGQGDSPSGRNNSFRRIGGDSSSLQKTNPFSSITTPGGGL
ASPTGGASNAFGLGSGAFASFGSAKTPKATGNPFESSLGAAVKTPGAEKSAKEGGLAGKS
VGRVASNASLLDSARTSGASVHRLRDSWVFWFRPPISKANGFIEYENTLHPIASVDTAEN
FFGVYGHLKRPSTLPLVSDYHLFKKGIRPIWEDQENKAGGKWVVRLKKGVADRYWEDLLF
AIIGDQFGEASEEVCGIVVSIRNGEDILSIWTRSSGQRVLKLRETMRRVLSMPNDTKIEF
KSHDTSIQQRTAIEESRREKAANNHHGDKRNNKQQHYQQQLQQSNDEQQKNL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagaacatatggagtcgccgccccggttcgagcaagctctccctctctacttccggc
tccggtcagggcgacagcccctctggacgcaacaactctttcaggcgaatcggcggtgat
agctcttcgctccagaaaaccaaccccttcagttccataaccacgccgggaggcggcttg
gcgtcacctacaggcggcgcatcgaatgccttcggcctaggatctggcgcctttgcctct
tttggttcggcgaagacccctaaggcgactggaaatcctttcgagtcgtctttgggcgct
gctgtcaagacacccggtgcggagaaatctgcaaaggagggtggcttggctggcaagtct
gtcggccgggtggcatccaacgcctccctgcttgactctgccaggacgtcaggagcgtca
gtccaccggctgcgtgacagctgggtgttctggtttcgcccgcccatctccaaggcgaac
gggtttatcgagtatgagaacactctgcacccaatcgcctcggttgatacagccgagaac
ttcttcggcgtgtacgggcacttgaagcggccgtcaacactgccgctggtatcggactac
cacctcttcaagaagggaatccggccaatatgggaggaccaggagaacaaggcgggtggc
aagtgggtggtgcgcctcaagaagggcgttgcggaccgctattgggaggacctgctgttt
gccattattggcgaccagttcggcgaggccagtgaggaggtttgcggtattgtggtgagc
atccgtaacggggaggacatcctcagcatctggactcgttcgagtggacagcgggtcctg
aagctccgcgaaactatgcgccgagtcctgtcgatgccaaatgacaccaaaatcgagttc
aagagccacgacaccagcatccagcagcgcactgctattgaagagtcccggcgggagaag
gcggcgaacaatcaccacggtgacaagcgcaacaacaagcagcaacattatcagcagcag
ttgcagcagtcgaatgacgaacagcagaagaacttataa

DBGET integrated database retrieval system