KEGG   Podospora anserina: PODANSg8847Help
Entry
PODANSg8847       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
pan  Podospora anserina
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PODANSg8847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 359 aa AA seqDB search
MAGLFSSGTSSASASNTLGDLKNDVALANGPEDSISDIAFNPNPADTKDLLAVASWDKKV
RIYEIMSNGQGEGRVAYDHDGPVFSVDFFKDGTKVISGGADKQGKVVDLATSQTMQFAQH
DQPVRAVRYFENSGTPMAVTGSWDKTIKYWDFRQQTPVGTVTCQERVYTMDVRNDLLVIG
TAERYINVINLKDPTKFYKTITSPLKWQTRVVSCFTDSMGFAIGSIEGRCAIQYVEDKDA
SLNFSFKCHRDPPQGNVTNVYAVNDISFHPVHGTFSTAGSDGTFHFWDKDAKHRLKGYPN
VGGSIAATTFNKTGSIFAYAISYDWAKGYQGNTAGYPNKVMLHPVQPDECKPRPSVKKR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcaggccttttctcatctggcacgtcgtctgcgtcggcgagtaacaccctcggagac
ttgaagaacgacgtcgcgctcgccaatggcccagaagatagcatctccgacatcgctttc
aaccccaacccggccgataccaaagatctgttggcggtagccagttgggacaagaaggtc
cggatctacgagatcatgagcaatggtcagggagagggaagagtcgcgtacgaccacgat
gggccggtgttctcggtggactttttcaaggatggcacaaaagtaatctctggaggcgcc
gacaaacagggcaaggtggtggaccttgcaaccagtcaaaccatgcagtttgcgcaacat
gaccagcccgttcgcgccgttcgctacttcgaaaacagcggcacccccatggccgtaaca
ggctcctgggacaagaccatcaagtactgggacttccggcaacagacaccagtcgggacc
gtaacgtgccaggaacgtgtgtacaccatggacgtacgaaacgacctcctggtgataggg
acagccgagagatacatcaacgtcatcaacctgaaggatccaaccaagttctacaagacg
atcacaagtccgcttaagtggcaaacgagggtggtgagctgctttaccgactcgatgggc
ttcgccattggtagtattgaaggtcgctgcgccattcaatacgtcgaagacaaggatgct
agcctcaacttctcgttcaagtgccaccgtgatcccccacagggcaacgtcaccaacgtg
tatgctgtcaacgatatctctttccatcccgtccacggcactttcagcaccgcgggcagc
gatggcacattccacttctgggataaggacgccaagcataggctgaaagggtaccccaat
gtcggtggtagcattgctgccacgacgttcaacaagaccggcagcatatttgcgtacgct
atcagctacgattgggccaagggctaccagggcaacacagctgggtaccctaacaaggtc
atgctgcacccggtgcagccggacgaatgcaagcccagacccagcgttaagaagaggtag

DBGET integrated database retrieval system