KEGG   Podospora anserina: PODANSg8987Help
Entry
PODANSg8987       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pan  Podospora anserina
Pathway
pan00500  Starch and sucrose metabolism
pan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PODANSg8987
Enzymes [BR:pan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PODANSg8987
Glycosyltransferases [BR:pan01003]
 Polysaccharide
  Storage polysaccharide
   PODANSg8987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_transf_5 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 6195463
NCBI-ProteinID: XP_001911942
UniProt: B2B7J2
Position
2
AA seq 701 aa AA seqDB search
MADDGREPREVRNHLLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHQSA
AVEVEAIEPTNPELAATIQSMRDRGIGILYGRWLIEGAPRVLLFDTKTAYHYLNEWKTDL
WNVASIPSPDNDEETNEAVVFGYLVAWFLGEFVCHEKKKAVIAHFHEWLAGVALPLCKRR
RIDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERASAHSCDV
FTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQSKEKIHDFVRGHFYG
HYDFDPENTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKSSGSKTTVVAFIIMPAQTTS
LTVEALKGQAVIKSLRDTVDTIERNIGRRIFERSLKWHDGEPMPDDKEILTSQDRVLLRR
RLFAMKRHGLPPIVTHNMINDSEDPILNQIRRVQLFNHPSDRVKIIFHPEFLNSANPVLP
LDYDDFVRGTHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRNKGVDDSVNQLTSSMFDFTQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPTSFNGDEEEDYIPGPEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREGLS
TEDYVAWKLPEEEDPDEYPFPLTLRTKQPSGAATPPHVNGN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgacggacgcgaacctcgcgaggtcaggaaccacctcctcttcgagattgcg
acagaagtggcgcatcgtgttggtggtatctactctgtgatcaagtccaaggctccagta
acaactgctgaatatggcgaccgttacacgctcatcggaccccttaatcaccagtctgcg
gccgtcgaggtcgaggcgatcgaacccaccaaccccgagcttgctgcgacgattcagtcc
atgagggatcgtggcattggtattctgtatggtcgctggctgatcgagggtgcgccaaga
gtccttctctttgacacgaaaaccgcatatcattatctgaacgagtggaagacggatctg
tggaacgtggcctctatcccctcccctgataatgacgaggaaacaaacgaggctgttgtg
tttggttaccttgtcgcatggttccttggagagtttgtgtgccacgaaaagaagaaggct
gtcattgcccacttccacgagtggctcgccggtgtcgcccttcctctgtgcaagaggcgc
cgtattgatgttaccaccatcttcaccacccacgctacgcttctcggtcggtacctctgc
gccggctcggtcgatttctacaacaacctgcaatactttgacgtcgacgccgaggctggc
aagcgcggtatctaccatcggtactgcatcgagcgggcgtcggctcactcctgtgatgtc
ttcaccaccgtctcgcacattaccgcgtacgagagcgagcatctcttgaagcgcaagccc
gacggagtgctgcccaatggtctcaacgtcaccaagttctccgccatgcatgagttccag
aaccttcaccaacagtccaaggagaagatccacgactttgtccgcggtcacttctatggt
cactacgatttcgatcctgaaaacactctctacttcttcacggctggtcgctacgagttc
cggaataagggtgtagacatgttcatcgagtccctcgctcgtctgaaccaccgcctcaag
agctctggcagcaagaccaccgtcgttgcctttatcatcatgcccgcccagaccacctcg
ctgactgtggaggccctcaagggccaggccgttatcaagtcgctcagagacaccgtggac
acgattgagcgcaacattggcagacgcattttcgaacgctccctcaaatggcacgacgga
gagccgatgcctgatgacaaggagatcctcaccagccaggaccgtgtcttgcttcgtcgc
cgtctctttgccatgaagaggcacggacttccccctattgtcacgcacaacatgatcaac
gacagcgaggatcctattctgaaccagatccgtcgggtacagctcttcaaccacccatcg
gaccgcgtcaagatcatcttccacccagagttcctgaactctgcgaacccggtgctcccg
cttgactacgacgactttgtgcgtggcacacacttgggtgtctttgcgtcgtactacgag
ccatggggctacacgccagccgaatgcaccgtgatgggtgtgcccagcataacaaccaac
ctttccggttttggctgctacatggaggagttgattgagaattcgagcgattatggtatc
tacatcgtcgaccgccgtaacaagggtgtggacgactcggtcaaccagcttacctcgagc
atgtttgactttacacaaaagagccgtcgccagcgcatcaaccagcgcaaccggacggag
cgtctgagcgacctccttgactggaagcgtatgggcatggaatatgtcaaggctcgccag
ctcgccctcagacgggcctacccaacctcgttcaatggtgacgaggaggaggactacatt
cctggccccgagcaaaagatctcgcggccattctcggtgcctggctcgcccagggacagg
accggcatgatgactcctggcgactttgccagtctccaggagggtcgggagggactcagc
actgaggactacgtcgcgtggaagcttcctgaggaagaggaccccgatgagtacccgttc
cctctcacccttcgaaccaagcaacccagcggagcggcgacgccccctcacgtcaacggc
aactaa

DBGET integrated database retrieval system