KEGG   Podospora anserina: PODANSg9008Help
Entry
PODANSg9008       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 650 aa AA seqDB search
MGGVTFMEGNPDRKFPESRVLIIMTGGTICMQPSADGLVPMSGFLELAMAPRPSFNDSTA
PSTNITAYTKEGHKLTLSSLRTPTSAYCKHIRYSILEFSPLLDSSSIASAGWTDIALTIQ
QNYHLFDGFVILHGTDSLAYTASALSFMLSDLGKPVILTGSQASIFALQSDAVDNLLGSL
IIAGTFTIPEVCLFFHHTLFRGNRTTKVSASSFEAFDSPNSDPLAKVTSLGVDVNWGLVR
RPTRIKEFNVTKTLDTTHVASLRIFPGIWPQLVDSVLRVPDLRGLVLETFGMGNAPGGVD
GHLTKAIKQAVERGIVIVNVSQCTNGFVSPLYAPGTALGRAGVVFGGDLTTEAALTKLSY
LLALKDRGTVGLEEVKEMMGRSLRGEMTELRVASFVHPAGVVEEDVVGKITAAESAFTAL
GYAISNGDLRTVRELLEGDEFNHQLLKKADYAGNTAVHLAAVGPEPKILREVLERGASVH
VRNRANNTPLYLAEKMVASGTTPKSEECVGLLKEAGGHLWLENEESMANSRRGSVGGREN
GNGVNAKPAEEKLTLEVEAPLLGDPESFLWGGATEKVRQEHDAVWKNAMERVRKEQDSVI
ERARKELDTKLRQELAMVEAERARLLKIGDTPNVQGGADDIESTTGKIIN
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgtcactttcatggagggcaacccggaccggaagttccccgagtcccgggtc
ctcatcatcatgaccggcggcacgatttgtatgcagccctccgctgatggcctcgtccca
atgagcggctttctcgaacttgccatggctccccgaccttccttcaacgacagcacggct
ccgtccaccaatataacagcctacacaaaagaaggccacaaactcaccctatcctccctc
cggacccccacctcagcctactgcaaacacatccgctactccatcctcgagttctccccc
ctcctcgactcctctagcatcgcatcagcagggtggacagacatcgccctcaccatccag
caaaactaccacctctttgacggcttcgtcatcctccacggcaccgactcgctagcttac
accgcttcggccctgtcgttcatgctctctgatctcggcaaaccagtcatcctcaccggc
tcccaggcctcaatctttgccctccaatccgacgccgtcgacaatttactgggcagtctc
atcatcgcaggcacattcaccatcccggaagtctgcctttttttccatcacactttgttc
agagggaaccgcacaacaaaagtctcggcctcaagcttcgaagcgttcgactcccccaac
tctgaccccctggcgaaggtgacaagtttgggagtagatgtaaactggggtttagtccgg
cgcccaacccgcatcaaagaattcaacgtcaccaaaaccctcgacacgactcacgttgcc
tcgcttcgcatctttcccggcatctggcctcagctggtcgactctgtccttcgtgtccct
gacctgaggggtttggttctcgagacgtttggcatggggaatgcgccggggggtgtggat
gggcatctcacaaaggcgatcaaacaggcggttgagagggggattgtcattgtcaatgtc
agccagtgtactaatgggtttgtgagcccgttgtacgcgccggggacggcgctggggagg
gcgggggtggtgtttgggggggatttgacgacggaggcggcgttgacgaagctgagttat
ttgctggcgttgaaggatagggggacggttgggttggaggaggtgaaggagatgatggga
cggagtttgaggggggagatgacggagttgagggttgcgagctttgttcacccggctggg
gtggtggaggaagatgtggtggggaagattacggctgcggaatcagcctttacagcccta
ggctacgcaatcagcaacggcgacctccgcaccgtacgggagcttttggaaggggacgag
ttcaaccaccagctcctcaaaaaagcggactacgctggcaacacggccgttcatcttgcc
gctgtcgggcccgagccaaagatcctcagggaggtcctcgagcggggcgctagcgtacac
gtcaggaaccgggcgaacaacacgccgctttatttggcggaaaaaatggttgccagcggg
acgacgccgaagagcgaggagtgtgtcggtttgttgaaggaggcggggggccatctgtgg
ttggagaatgaggagagcatggctaatagccggaggggttctgtggggggcagggagaat
ggaaatggagttaacgccaaaccagccgaggagaagttgactttggaagtggaggctcct
ctccttggtgacccagagagttttctctgggggggtgcgacggagaaggtccgtcaggaa
cacgacgctgtgtggaagaacgcgatggagagagttcgcaaggagcaggattctgtcatt
gaaagagcacgcaaggagctggataccaaattgaggcaggaactcgcaatggtcgaggct
gagagggccaggctgctgaaaattggggatacgccgaatgtgcagggtggtgctgacgat
atcgagtcgacaacgggaaagatcatcaactga

DBGET integrated database retrieval system