KEGG   Podospora anserina: PODANSg9014Help
Entry
PODANSg9014       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pan  Podospora anserina
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PODANSg9014
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PODANSg9014
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PODANSg9014
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PODANSg9014
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PODANSg9014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 490 aa AA seqDB search
MPLRAKLLPQQQPQSRMMSSSSYAHFTPCPNDDPEDVLFQSLYGLRTIELNRPNKLNALN
GSMIRKIAPRLLEWSKSDMANVIVIKGAGRKGFCAGGDVQQLVEWNRDPTIDGPAKSAAY
FAQEYKLNHLIATYNKPYIAFMDGFTMGGGVGLSIHAPFRIATENTVFSMPETTIGFFPD
VGASFFLPRMAGEVGTWLALTSGQLKGVNAFYAGVATHYLHSSSLNALESRLAELRFKDY
DQMSRRLEVVNDTIEEFVTGLPWEEPMAVAGEVRRAIDRCFGFDTVDEIMHALREEEKNE
VTGEWATKTLNTLHLRSPTSVHVTLKQMRIGKTWSIAEAFKREHSIATKFMSYPDFNEGV
TAKLVEKPRRVPMWQPASLERFTEKKDWKELVGSFFLVDDKGPKFKLLSEETYDKYPFKN
FGVPTEEEVEQKVAEGKVKSRAEVLEHFVRERRQKQGVEVVVSEILLRKTKEGKKGLTWV
YGEEAPGQQE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcagagctaagctgctgcctcagcagcaaccacaatcacgaatgatgtcctcc
tcctcctacgcccacttcaccccctgccccaacgacgaccccgaagacgtcctcttccaa
tccctctatggcctccgcaccatcgagctcaaccgccccaacaagctcaacgccctcaac
gggtccatgatccggaaaatcgcaccccgcctcctcgagtggtccaaatccgacatggcc
aacgtcatcgtcatcaaaggtgccggccgaaagggcttttgcgcgggtggtgacgtccag
caactcgtcgaatggaaccgagaccctaccattgatggccctgcgaagtcggctgcctac
tttgcccaagagtacaagctcaaccatctgatcgccacgtacaacaagccatacattgcc
ttcatggacgggttcaccatgggcggtggggttggattgagcattcatgccccttttagg
atcgccaccgagaacacggtgttttctatgccggagaccacgattgggttttttcccgac
gtgggcgcgagttttttcctgccgaggatggcgggggaggtggggacttggttggcgctg
acgagcgggcagttgaagggggtgaatgctttttatgcgggggttgcgacgcattatctg
cacagctcgagcttgaacgcgctggagagcaggctggccgagttgaggtttaaggactat
gaccagatgagcaggaggttggaggttgtgaatgatactattgaggagtttgtcacggga
ctgccgtgggaggagccgatggcggttgcgggggaggtgaggagggcgattgataggtgt
tttgggtttgacacggtggatgagattatgcatgctttgagggaggaggagaaaaatgag
gttacgggggagtgggcgacgaagacgctgaacacgttgcatttgaggagcccgacgtcg
gtgcatgttacgttgaagcagatgaggattgggaagacgtggagtattgctgaggcgttc
aagagggagcattcgattgcgaccaagtttatgtcttatcctgattttaacgagggggtt
acggctaagttggtggagaagcccaggagggttccaatgtggcagccggcgagcctggag
aggtttactgagaagaaggattggaaggagctggtgggttcgttctttttggtggatgat
aaggggccgaagtttaagctgttgagcgaggagacgtacgacaagtatcctttcaagaac
tttggcgtgcctaccgaggaggaggtggagcagaaggtggccgagggcaaggtcaagagc
agagcggaggtgttggagcattttgttagggagaggaggcagaagcagggtgttgaggtg
gttgtgagcgaaattctgttgaggaagacaaaggagggcaagaagggtttgacttgggtg
tatggggaggaggcacctgggcagcaagagtag

DBGET integrated database retrieval system