KEGG   Podospora anserina: PODANSg9036Help
Entry
PODANSg9036       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pan  Podospora anserina
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pan00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 632 aa AA seqDB search
MTIPQTKVATATSVAIRALSYFFLRWPFPALIFALFAVYLPSFVSGYLHEPKQELVDQVD
VTVTDIPIEVEVPENGRRNRGTEKLVAEQVAVEETLTIEDRPLNPLKTLLSGAPNPRSLL
LSATTLLINAICVGMVADRLFTERYHTGDDLSFARLGFVSEHEAKLLIREPDQSKMPVTV
EVHIKDPVAPFDNPLWQSAGGIKFTTNETDYTAVVPIPLRNSKMRTYQWRTSNNHTGEFT
TPPPVGHAEEATTGPFTFLSTSCIVSRLPYSPFDHPLAIPGFRYLAKVLPTLNAQFMLFL
GDFIYADVPRYWGSSKSDYRQKYRQVYASPDWPSVGQNLSWIHTLDDHEIANDWSANSTG
VYKAAFDPFEHYQAAANPPPARRAGGIAARKSATYYSFTQGPASFFLLDTRTFRSDNHLP
DTAEEQKTMLGPEQLEDFLAWLKKPEPKGVKWKIVASSVPFTKNWPVNTQDTWGGFLTER
RKVLEAMWDVSRRGVGVVVLSGDRHEFAATKFPPPVPVLVEGEGEGEVHVEGRAWPEEAT
VWEFSASPLSQFYSPVGTYRERDGEDVMVKYIHKGNSKFGAITIENLEGGDQSSLKYRLF
VDGEEVWNTVLLSPKGDQAPARGSFWSKLIGA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgacgataccacaaacgaaagtcgcgacagcgacatcggtcgctatcagggcactcagt
tacttctttttacgatggccatttcccgcccttatctttgcgttattcgctgtctacctg
ccatcatttgtgtcgggatatctgcatgagccaaagcaggaactagttgatcaagttgat
gtcacagtaacggacattccaatcgaggttgaggttcccgagaatggcaggagaaaccgc
gggaccgaaaagctggtggccgaacaggtggctgttgaggagaccctcacgatcgaagac
agacccctgaaccccttaaagacactgctctctggtgcccccaacccgcggagtttgctt
ctgtcagctaccacgcttctcatcaacgctatctgcgtcggcatggtcgctgaccgtctg
ttcaccgagcgctatcacactggcgatgacctctcttttgccagactcggctttgtctct
gaacatgaggccaagcttctcattagagagccagaccagtccaagatgcccgtcaccgtc
gaagtacacatcaaggacccggtggcgccttttgacaaccccctgtggcagagcgctggt
ggtatcaagttcaccaccaacgaaaccgactacaccgccgttgttcccatccccctccgg
aactccaagatgcgcacctaccaatggcgcacctcgaacaaccacaccggagagttcacc
acccctcctcccgtcggccacgctgaagaggccaccaccggccccttcaccttcctctcc
acctcctgcatcgtctcccgactcccttactcgccgtttgaccaccccttggccatccca
ggcttccgctacctcgccaaggtcctccccaccctcaacgcgcaattcatgctcttcctg
ggagatttcatctacgccgacgtgccccgctactggggaagttcaaagtctgactacagg
caaaaataccgccaggtctacgcctcgcccgactggccttctgtcggtcaaaacctcagc
tggattcacaccctcgacgaccacgaaatcgccaacgactggtccgccaactcgacgggc
gtctacaaggcggcttttgacccctttgagcactaccaagcagctgccaaccctcccccg
gcacgcagagcaggcggcatcgccgctcgcaaatcggcgacgtattactccttcacccaa
ggtccggcgagctttttcctgctggacacgaggacgttccggtcggataatcatcttcct
gatacagccgaggaacaaaagactatgcttggccctgagcagctggaggactttttggcg
tggctcaagaaacctgagccgaaaggggtcaagtggaagattgtggccagctcggtgccg
tttacgaagaactggccggttaacactcaggatacgtggggtgggtttttgacggagagg
aggaaggtgctggaggcgatgtgggatgtttcgaggaggggggtgggggttgtggtgctt
agtggggataggcacgagtttgctgcgaccaagttcccgccgccggttcccgtgctggtg
gagggagagggagagggggaagtccatgtggaggggagggcgtggccggaggaggcgacg
gtgtgggagttttcggctagtccgttgagtcagttttatagtccggttgggacttatagg
gagagggatggggaggatgtgatggtcaagtatattcataagggaaactccaagtttgga
gcgatcactattgagaatttggagggcggtgatcagagcagcttgaagtataggctgttt
gtggacggggaggaggtgtggaacacggtgcttctgtcgccgaagggggaccaggctccg
gcgagggggtcgttttggagtaagttgattggtgcttag

DBGET integrated database retrieval system